KEGG   Puccinia graminis: PGTG_01242Help
Entry
PGTG_01242        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pgr  Puccinia graminis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PGTG_01242
Translation factors [BR:pgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PGTG_01242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 254 aa AA seqDB search
MSDWEASDHEEAANAGISVAAGVSAIKKNKWADEDADEDVKDDWEASESEDEKSKNEPAK
PKGPVRNKGITKMKIAEKEAEEALRLAEQEALAQQAADPVLRKKLEQTRTIQSDMENARG
LFGDAVVSNPNSSEDPMKMDPKTKADFESMSSALAQLIVSKHGNKPLYPLFVEHFFRQLS
EPLSDVQTRKTASILTTIANEKQRAAKDAKKGKGKLKPTLGGGVVSGASKGGRGVNADLE
VYDQALDDEFDDFM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattgggaagcaagtgaccacgaagaggcggcgaacgcagggatctcagtagca
gcgggggtgtcggcgatcaagaagaacaaatgggcggacgaggatgcggatgaggatgtg
aaagatgactgggaggcgtcggagtcagaagatgagaagtcaaagaatgaaccagcgaag
cctaaaggtccggtgaggaacaaagggatcaccaagatgaagatcgccgagaaggaggcc
gaggaagccttacggttggccgaacaggaggctttggcccagcaggctgccgaccccgtc
ttgaggaaaaaactcgaacagactagaactattcagtcggatatggaaaacgctcgtggc
ttgtttggtgatgcggtggtctcgaatccgaacagctctgaagatcctatgaagatggat
cccaagacaaaggctgatttcgagtcgatgtcgagtgcgctagcccaactgattgtttcc
aagcacggcaacaagccgctatatccactttttgtagaacatttcttcagacaactctcc
gagcctctaagtgatgtccagactcggaagacggcctcgattctgacgacgatcgcgaat
gagaaacaacgagcagccaaggatgccaagaagggcaaaggcaaactgaagccgacctta
ggcggcggggtggtttcgggagccagcaaaggcggacgcggtgtcaatgccgatctggaa
gtctatgatcaagcactggacgatgaatttgacgattttatgtga

DBGET integrated database retrieval system