KEGG   Puccinia graminis: PGTG_01301Help
Entry
PGTG_01301        CDS       T02226                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
pgr  Puccinia graminis
Brite
Exosome [BR:pgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGTG_01301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 146 aa AA seqDB search
MPPKSTTAEKKPASTASKAPASKATSSAAPADKKTAKKSTKPVDGEKKKRKKKRNETYGI
YIYKVLKQVHPDTGISNKAMLIMNSFVNDIFERIATEASKLALYNKKSTISSREIQTAVR
LILPGELSKHAISEGTKGVTKYTSSK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccacccaaatctaccaccgccgagaagaagcccgcctcaaccgcctccaaggcccct
gccagcaaggccaccagctcggctgctccggctgacaagaagactgccaagaagtcaaca
aaacctgtcgatggcgagaagaagaagcgaaaaaagaaacgtaacgagacctacggtatc
tacatctacaaggtcctcaaacaggtccaccccgacactggtatctcaaacaaggctatg
ttgatcatgaactccttcgtcaacgacatatttgaacggatcgccaccgaggcctccaag
ttggccctctacaacaagaaatccaccatctcatcccgagagattcaaaccgctgtccga
ctcatcctccctggagagctctccaagcacgccatctcggaaggaactaagggtgtcaca
aaatacacatcctcaaagtga

DBGET integrated database retrieval system