KEGG   Puccinia graminis: PGTG_01719Help
Entry
PGTG_01719        CDS       T02226                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pgr  Puccinia graminis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PGTG_01719
Enzymes [BR:pgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PGTG_01719
Exosome [BR:pgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGTG_01719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 337 aa AA seqDB search
MTTEPSSTATPLSHVLQGGYAHPLTRSLQAERSLTKDMLMFPLFISDDPDAKQPINSFPN
QYHLGINVLEDFLRPLIDKGLRSVILFGVPMKCKKDARGTPADDETGPTISAIRLLKLKF
PTLFVAADVCLCEYTEHGHCGFAPGKPGGEIDTPVSVARIAVVALSYARAGADCVAPSDM
MDGRVGAIKQALIDARLANRCCLMSYSAKFASSLYGPFRAAACSAPSFGDRKGYQLPPNA
RGLARRAIVRDISEGADIIMVKPAQMYLDVLSEARSLAPSHPLACYQVSGEYAALLAGAD
AGVYELKPMVFESLDCMLRAGATLILTYFTPMLLDWL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaaccgtcctccacggctaccccgctcagccatgtccttcagggaggatac
gcgcatcctctgacccgatcactccaggctgaaagatctttgaccaaagacatgttgatg
ttcccgctcttcatttccgacgatccggacgccaaacaacccataaattcttttccaaat
caatatcacttaggaatcaacgtactcgaagatttcctgcgtccgttgatcgataagggg
ctacgatcagtcattttatttggggtacccatgaaatgtaaaaaagacgccagaggcacg
ccagcagatgatgagacgggtccgactatctcagccatacgcttactcaagttaaagttt
ccgactctatttgtggcggcggatgtgtgcttgtgcgaatatacggagcatggtcattgt
gggtttgcgccaggcaaaccgggtggcgagatcgacacaccggtctcagtggccaggatt
gccgtcgtggcgctgagctatgcccgagcgggtgcagactgtgtggctcctagcgacatg
atggacggcagagtgggggccatcaaacaggctctgatcgatgctagactggctaatcga
tgctgtctgatgtcatactcagccaaattcgccagctcactctacggcccctttcgcgcg
gccgcttgttcagcaccatcattcggggaccgcaagggatatcaactgccgcccaatgct
cgaggactggcgagacgagcgatcgttcgagatatttcggaaggagcggatatcatcatg
gtgaagccggctcagatgtatcttgacgtactttccgaggcccgatccttggcaccttct
catccgttagcctgttatcaggtttcaggagaatatgctgccctcttggccggtgcggac
gccggggtgtatgaattaaagcctatggtcttcgagagtttagattgcatgcttcgtgct
ggtgccactctgatactcacttacttcacccccatgctattggattggctctga

DBGET integrated database retrieval system