KEGG   Puccinia graminis: PGTG_01874Help
Entry
PGTG_01874        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pgr  Puccinia graminis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pgr00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 570 aa AA seqDB search
MAQAQQSDSAPSPSSTANSLSQQLTQQTLLLSSLVGASGGYQRVSLLQSDRSLSLLFSHP
KGRTSCLPFRASRKNPENKIEIEYRNILNCQLNQQEQENYELKLSYLKSSQDQNLKLKTL
TLIGRIENESDTSSDTQKLTQNWVENLLLRSYEFKGVPRSRRVLIVINPTSGSQKSVKIW
TSVVEPILKASTANYEVIFTTHAGHAGELGEKLDLDSVDVVSCVSGDGLVHEILNGLGRR
ESDFGTAMEKLALTSIPCGSGNALSTNHLGPKHAKNVQLATLNILKGTPIRLDLCSSTQL
SDGVPEGQKEPESIRKLSLLSTSYGIMAELDVGTEHLRRLGPIRFVLGYLWGAIRNRQRK
IRLDVQLVEKDKTEIERNFRLLRETIKQESSDPNRTPTLPDHHQPAVEADSSGLPRLKYG
DIRTKIGGSEDSNSTCPWTTIETDIVSFYAGILPFMSRELLLFPAKIPGRDGTIDITLQH
SDSVWKSLACLIGAETGGLFKNPNCEFMKVKAFRLTFDSDEKNRSYVVLDGENLPYQSIQ
VEIHERAFQSLTLNSECPYFGSIGVADQIL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagctcaacagtccgactcagccccctcaccaagctcaaccgccaactcacta
agccaacagctcacccagcagaccctcctactcagcagcctcgtcggagcaagcggtggc
tatcaaagagtcagcctgctccagtcggatcgatcactaagcctgctcttcagtcatccc
aagggaagaacttcctgtttaccattcagagcatcccgcaagaatcctgaaaacaagatc
gaaatcgagtacagaaacatcctcaactgccaactgaaccaacaggagcaagagaactac
gaactcaaactatcatatctgaaaagctcgcaggaccagaacctcaaactcaagacgctc
acactgattggaagaatcgaaaacgagagtgataccagcagcgatactcaaaaactcact
cagaattgggtcgaaaacttactgttgagatcttacgaattcaaaggtgttcccagatct
cgtagagtcctcatcgtcatcaatccgaccagtggctcacagaagagtgtcaagatctgg
acatcggtcgtcgaacccatcctgaaagcatcaaccgcaaactatgaagtgatatttacc
actcatgcaggacatgcaggagaactcggagaaaagttggaccttgattcggtcgatgtc
gtcagctgtgtgtccggcgatgggttggtgcacgaaatcttgaacggacttggtcgtcgg
gaatcagatttcgggacagccatggaaaaattagctttgacctcgattccttgtggctcc
ggaaatgccctttcgactaaccatctcgggcccaaacatgccaaaaacgttcaactggcc
actttgaacatactcaaaggaacccccattcgactggacctatgcagctccacccagctg
tctgacggagttccagaaggacagaaagagccagagtcgatccggaaattatccctgctc
agtacctcatacggaatcatggccgagctcgatgtgggtacagaacatctcagacgctta
ggtcctatccgcttcgtcctaggatatctatggggtgcgatccgaaatcgtcagcggaag
atcagattagatgtccaattagtcgagaaggacaagaccgaaatcgagcgaaactttcga
cttctccgtgagacgatcaagcaagagtccagtgatcccaaccgaaccccaacccttcca
gatcaccaccaaccagcagtcgaggcggattcgagcggactgccgcgactgaagtacggc
gatatccgaacgaagatcggcggttctgaggacagtaactcgacgtgtccttggacaacc
atcgaaaccgatatcgtctccttttatgccggcatcttgccgttcatgtcgagagaactc
ttgctctttcccgctaaaattcctggccgcgatggcactatcgacatcaccctacaacat
tctgacagcgtttggaagtccttggcatgcttgatcggagctgaaaccggcggtctattc
aagaaccccaattgcgagtttatgaaagtgaaagcgttcagattgacgttcgactcggac
gagaagaaccgatcgtatgtcgtcctggatggcgaaaacctgccctaccaatcgatccaa
gtggagatccacgagcgggccttccagagcttgacgttgaactctgagtgtccatacttt
ggctcgatcggcgtcgccgatcagatcttataa

DBGET integrated database retrieval system