KEGG   Puccinia graminis: PGTG_02021Help
Entry
PGTG_02021        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
pgr  Puccinia graminis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PGTG_02021
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PGTG_02021
Peptidases [BR:pgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGTG_02021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1235 aa AA seqDB search
MSSTPNQDLLKDLPLHILKQKAAVENQPNVSLTDWIKQAAQTYAAATDADSSNQTESAYY
HYFKAAGILQLILKHPGFPTLKSQHPAEYRVYLEFTPKILASTERAKTLAEIIQNPPESS
PPIPSSSKITTARRPIAGGISDRIKLFESSKSSERPPPSSPIIRDQSKIQHSSPTSSPKV
DGRRQSGIPQPNGLPDPTPQPSFVSTALEAESTIRSGSAPPELTIENPSSGASDKPKLKH
TIGNGLPHTNGDSPSHHQRQSNLHHEQIRTPSQFNQAFPALEDPPSNELTQSEDPLPSHP
LPSLPSVPSTLPVKSFSPLPPPPQPFQVPSSDPDLDSQPTTYSVSDPLVNDITLGAGITK
HSLPNRNSSPVGAPPPYPNFEIEALSRSPPREKSPFSRSPDLKSPHSLRGPRSIDWTLSS
PKNPALNYSPLKPAQSSDTLPRLPSDANEILPATLIDYFRRSAACGFDTKVLFLDVRNRE
DFESCRIKSTDVICIEPLILSKNGGRGVSSKEIEDSLVISPKKEQALFQNRTSFDYVIIY
DKRSVQLPAHRSKSELLYSSDPTEEAARLLLLLYLAIHKEEYIHQLKQPPMLLSGGIEGW
MKVAGEVGVVGRGISVAPQQSYQTPYSTEITSSLNGISITLRQPLNADGDGNRNGIGNEN
LNGHTDLKRARRQVAVFQRDDSNLNQNHIIRSIPDLTTRPNGIPYHPPTSTSMPTFQPSR
PPSYSSSSYRNNGIASSPITLPQQTLQRLKSTELYDGNHPSNEPVPSGYSSTPSNHMPLT
LYQPHSRPPVPPPPINYGPQPPLPLASHPIDVRYGGFMANPIRSAIQYPPLQSHPRPLQP
PPAAMTPGGSSAMPSYFNRAPAYAPHPPQPALLGIDSRNTPPHHPLFGESTRALAKYTST
LVSRMCLSATIPLARFFKDGSYKRCINRTNPLGTQGLLAESVAELVRVLWGAQYTFVSPI
TFKDAICRFAPKFRGSDQQDAQGSPNKPPPLEMTPEREAALETLPTQIASAKEWEIYKRR
DNSVIVELFQGQYRSRLQCLTCNTTSTTYNTFMYLSLPIPNKRGISKVSLTQCLDAFLKE
EIMEKDDAWNCPKCKTRRKATKRLSLAKLPPILLIHLKRFSFKGPFSDKLETFVQYPLYG
LDLSSYVPPPLSPAALSNELKPVYEDVATRSSPESNIYDLYAVCNHFGSLSSGHYTAFAR
SQKDWYNIGDSRVSKTDEKSVKARSAYLLCFRRRG
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccactccaaatcaagacctactcaaggatctccccctacacatcctcaagcag
aaagcagcagtagaaaatcaaccgaacgtctcactgacagattggatcaaacaagctgct
cagacctatgcagctgccaccgatgccgactcatcaaatcaaacagaatcggcttactat
cattacttcaaagctgctggcattctccagctcatcctcaagcatcctggatttccaaca
ttgaaatcacaacaccctgccgaatatcgagtctatctcgagtttacgcccaagatccta
gcctctaccgaacgggccaagaccctagccgaaatcatacaaaacccacccgaaagctct
cctccaatcccttcctcatccaaaataaccactgctcgccgaccgattgccggtggaata
tcagaccgcatcaagctcttcgaatcttctaaatcatccgaaagaccacccccctcctct
ccaatcatccgagatcaatccaaaatccaacattcatccccaacttcatcacccaaagtg
gatggccgaaggcaatccggtatcccacaaccaaacggactccctgatcctacccctcag
ccgagtttcgtttccactgctctagaggccgagtctaccatccgctccggatctgcacca
cccgaattaaccattgaaaacccttcctccggcgcaagcgacaaacctaagctcaagcat
accatcggtaacggtttgcctcacacaaatggcgattccccttcacatcatcagaggcaa
tcaaatctacaccacgaacaaattcgcacaccttctcaattcaatcaagcttttcccgcc
ctagaagaccctccatcgaatgaacttacccagtcggaagacccactgccttcacatcca
ctcccctctctgcctagtgtcccttcaacgctcccagttaaatcattttctcctctcccc
cctccaccccagccgtttcaagtcccatcctccgatcctgatctcgactctcaacctaca
acatattcagtctcggaccccttggtaaacgacatcacacttggggctggcatcacaaag
cacagccttcccaacaggaattcctcacccgttggggctccaccaccttatcccaatttc
gaaatcgaagctctatcgcgttctcccccacgtgaaaagtcgcccttcagtcggtctcct
gatttgaagtctcctcatagtcttagagggccccgcagtattgactggaccctctcttcg
cccaaaaaccccgcattgaactacagtcctttgaaaccagcacaatcctctgatactctg
ccaaggttaccgtccgatgcaaatgaaatcttgcctgctacgttgatcgattacttcaga
aggtcggctgcttgcggatttgacacgaaagttttattcttggacgtgcggaatcgcgaa
gatttcgagtcttgtcgaatcaaatctactgatgtgatttgcatcgaacctctgatcctg
tccaagaatggtggaaggggtgttagttcgaaggagatcgaagactccttggtaatatct
cccaagaaagaacaagcattatttcaaaatcgtacaagcttcgattatgtgatcatatac
gataaacgttccgtccaactgccagctcatcgttcgaaaagcgagttactctactcatca
gatccaaccgaggaagccgccagattgcttttattgttatatcttgccattcacaaagag
gaatatatacaccaattgaaacaaccgccgatgctactcagtggaggaattgagggttgg
atgaaagttgcgggagaagttggcgttgtcggccgaggcatctcggttgctccccaacaa
tcttatcagactccatattccaccgaaatcacatcatccttgaatggtatctcgatcact
ctgaggcagccattgaacgccgatggcgatggaaatcgaaatggaatcggaaatgaaaat
ctgaatggtcacactgatcttaagcgagctcgtcgccaggttgcagtattccagcgggac
gactcaaatctcaatcagaaccatatcattcggtcgattccagaccttacaacacggcct
aatggaattccctatcaccctcctacatcaacgagcatgcctacctttcagcccagtcgc
cctccatcatattcgtcaagcagttatcgcaataatggaattgccagctcacccatcacc
cttccccaacagacccttcaaagactaaagtcaacagaactatatgatggaaatcatcca
tctaacgaaccggtaccatctgggtattcatcaacaccatcaaatcatatgccactcacc
ctttaccaacctcactcccgacctccagtcccaccaccacccatcaactatggtcctcaa
ccgcctctgcctcttgcatctcacccaatcgacgttcgctatggtggatttatggccaat
ccaatccgctcagcgattcaatatccacccctccaatctcatcctcgcccccttcaacct
cccccagcggccatgactcccggcggatcaagtgccatgcccagctacttcaaccgagcc
cccgcctatgcccctcatcctcctcaacccgcgttactcggtattgactctcgaaacaca
ccaccccatcacccccttttcggcgaatcgacacgggccctagcgaagtatacttcaacc
ctagtttcgaggatgtgtcttagtgccaccatcccactggcacgattcttcaaagatggc
tcttataagcgttgtatcaatcggacgaatccactgggaacacagggcttgctggccgaa
tctgtcgccgagctagtgagggtactttggggtgcccaatacacgtttgtctctccgatt
acgttcaaggatgcgatctgtcggttcgcccccaagttccgcggctctgaccaacaagat
gcgcaaggatcacccaataagcctccgcctctcgagatgacccccgagcgggaggcggct
ttggagaccttgcccacccagatagcatccgcaaaggaatgggaaatttacaaacggaga
gataatagcgtgattgttgagctcttccaaggccagtatcggagccgattgcagtgcttg
acttgtaatacgacttcgacgacttataacacgttcatgtatctttctctgcccattcca
aacaaacgcgggatcagtaaagtcagtctcactcaatgtctcgatgccttcttgaaggag
gagataatggagaaggatgatgcatggaactgtccgaagtgcaagacgagaaggaaagcg
acgaagcgattatcgctagccaagctgccaccgatcctactaatccatctgaaacgcttc
tcattcaagggtccattctcggacaaactggagaccttcgtccaatacccgctctacggc
ctcgacctgtccagctatgtccctccgcccctctctcccgcggcgctgtctaacgaactc
aaaccggtttatgaggacgtggctactcggtcaagccctgaatccaatatttatgacctt
tatgccgtctgtaatcatttcggtagtcttagtagtggccattataccgccttcgctcgt
tcccagaaagattggtataatatcggcgatagtcgggtctccaaaacagatgagaaatcc
gtcaaggcccggagtgcgtatttgttgtgtttccgaagaagaggataa

DBGET integrated database retrieval system