KEGG   Puccinia graminis: PGTG_02278Help
Entry
PGTG_02278        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
pgr  Puccinia graminis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pgr03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1065 aa AA seqDB search
MLSVDHCHSRVTPDREPVVGERLATPCDRKLKSVFAPHQCLWRKLQTRKNKTWEGDGILC
IRGSSCYIKSRDDGSQVASGQWVVDRDCVPGKIYMVGGKEVEIDQPISQQELEQEAKSNR
WDHPVTSALPAQPHVTKTKVVSKVTPKVDLKFKPPMRLNTLNRPSNLTQVDQSKYFAKPT
AGQPFNAPSTLLSSGLKRTKVEYLSHGEIDTLTTGKEPKRFKPLLLKTLDSSPEVKPISQ
EAHQDRAFVCLYRKLKASKNSTWDGDGILCIERSQRGPIAVLKDSTNRKVLGSTLLGRNP
SLESGSVIQVGSREAEIQRQATESESLDCESNSQETRKADWTDIVKNEAPVGSFKDPMLI
KRTSHTGPKFDPQAEGALVLTKPSTAWLLKHDLQNAAIVDVVVDPSIARSLRPHQVDGLK
FMYECTMGLREVGGHGCILADEMGLGKSIQAISLLWTLLRQNPISGQGPVIKRAMIVCPV
TLVKNWKREIHKWLGRSRLNVFTADGKCDFKQFTCSLYYNVLVIGYEKLRTLSKEVNSIY
PPIGLIIADEGHRLRSIEAKTTQALRSLKTKRRVVLSGTPIQNNLTEYYAMVDFVNPGIL
DDYRTFKKKFEQPILKSREPCCNPVQRSEGEARAEELAKMSRHYVLRRGSEVIQEHLPPR
HDYCVFISPTTVQRNIYEAVLDSPETRAIFSGDISQHLVLMNTLKLLCNSPGLLMNEYSI
KSLGQISSTLFPAWVTREDVQLSGKLIALAKFLDILKKKNNEKIILVSNFTKTLDIVESH
CKASHYPFCRLDGKTAQNQRDNIVQVFNRSSASAQFIFLLSSKSGGVGLNLIGASRLILF
DGDWNPATDLQAMARIWRQGQQKPCHIYRFLTTGTIDECIFQRQVTKIGLATDLMSAPKA
GEETAGGGNTFTKNELKRVFELHSDTDCYTHDLLECQCLENKSIEEPEGWKEEDEREDPM
ACLDHSDSEASLPDADLSGFLPASKYKPSEKEDAFKLKRKLAELEKWVHVNATDPKSVDE
LEDEILNQTVSALNPNLSKKSEKHSQDDQTAKDGIITFIFTKSIG
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgctctctgttgaccactgtcacagtcgcgtcacaccggatcgtgagccggtggttggt
gaaaggctcgcgacaccctgtgacagaaagctgaaatccgtctttgctcctcatcagtgt
ctctggcgaaaacttcaaacgcgtaaaaataagacttgggaaggcgacgggatcctgtgc
attcgaggttctagttgttacatcaagtcccgtgatgatggatcccaagtggcatctggt
caatgggtagttgaccgcgattgtgtaccaggcaagatttacatggttggaggcaaggag
gtcgaaattgatcagccaatttctcagcaagagctagagcaagaagcaaaatcaaaccga
tgggaccacccagttacctctgcacttcccgcccaacctcacgttaccaaaaccaaagtc
gtctcgaaagttacccccaaagtcgacctcaaatttaaacctccgatgcgccttaacacc
ttaaatcgaccatcgaacttaacccaggttgaccagagcaaatattttgcgaaaccaact
gctggtcaaccattcaatgccccttccaccctgctctcgagtgggctcaagcgcacaaaa
gtcgaatatctttctcatggtgaaattgacacgttgacaacaggaaaagagcctaaacga
tttaagcctcttttgctcaaaaccttggacagttcgcctgaggttaagccaatttcgcaa
gaagcacatcaagatcgcgctttcgtctgcctatatcgcaagctcaaagcctccaagaac
tcaacttgggacggtgacggtattttgtgcatagaacgatcgcaaaggggtcctatagct
gttttaaaggatagtacaaaccgtaaagtattgggaagcacgcttttgggacgtaacccc
agcctagaaagcggttcagtgatccaggtaggaagtcgagaagctgaaattcaaaggcaa
gccacagaatcagagtcattggattgtgagagcaattctcaagaaacgaggaaagctgat
tggactgacatagttaagaacgaggcccccgttgggagtttcaaagatccaatgcttatc
aaacgcaccagccacactgggccaaaatttgaccctcaagccgagggcgcgttggttttg
acaaaacctagcacagcatggttgctgaagcacgaccttcagaatgccgcgatcgtcgat
gtggtagttgatccttccatcgcccgatcactcaggccacatcaagtcgatggactcaag
ttcatgtatgaatgcactatgggacttcgcgaagtcggcggtcacggctgtatcctggca
gatgagatgggtctgggaaaaagcatacaagcaatttccctactatggactcttttgcgg
caaaatcctatctcagggcaaggaccagttatcaagcgagcaatgatagtttgcccagtc
acattggtgaaaaactggaagagagagatacacaaatggcttgggagaagccggttgaat
gtatttacagctgatggaaaatgcgactttaaacaatttacctgcagcctttattacaac
gttttggttatcggatatgagaaattaagaactctatccaaagaggttaattctatttac
cccccgatcggtttgattattgcagatgaaggccatcgcttgaggtccatcgaggccaag
acgacgcaagctttgaggtccttgaaaactaaacggcgtgtggtcttatctggcactccc
atccagaacaatcttacggaatattacgccatggtcgatttcgttaaccctgggatccta
gacgattatcgcactttcaagaagaaattcgagcaaccgatactcaagagtagggaacct
tgttgtaacccagttcaaagatcggaaggcgaggcgcgagcagaggaactggctaaaatg
agccgccattacgtgttacggagaggctctgaagtaattcaagaacaccttcccccccgg
cacgattactgcgtattcatctcacccacaactgtccaaagaaacatatatgaagctgtg
ctcgattcgccggaaaccagagccattttttccggggacatcagtcagcatctcgtcctg
atgaatactttgaaactcctctgtaattcgcctggattgttaatgaacgaatattcgatc
aaaagcttggggcaaatttcttccaccttattcccagcttgggtcactcgtgaggatgtt
caactttcaggcaaattgatagcattggcaaagtttttagacatcttgaaaaagaagaac
aacgagaaaataattttagtgtcgaactttaccaagactcttgacatcgtggagagtcat
tgtaaggcgagccactacccattttgtcgtctggatggtaaaacggcccaaaaccagcgg
gacaatattgtccaggtcttcaaccgatcatccgccagcgctcaattcatttttttgcta
agtagcaagtctggtggagttgggctgaatctgatcggggcctcacggttgatcttgttt
gatggggattggaacccagcaactgatctgcaagcaatggcacggatttggagacagggg
cagcaaaagccgtgtcacatctatcgctttctcaccacaggtacaattgatgaatgcatt
ttccagcggcaagttaccaagattggtttggcgacagatttgatgagtgctcccaaagct
ggcgaggaaactgcaggtggtggtaacacgtttacgaaaaacgagctcaagagggttttt
gaactacacagcgatacagactgttatacgcatgacttacttgagtgtcagtgcctagaa
aacaaatcaatcgaagaaccagaggggtggaaagaggaagacgagagggaagatccgatg
gcttgtctggaccactcagattctgaagcctctcttccggacgcagacttatcaggattc
ttacctgcatctaagtataaaccatcagagaaagaagatgcattcaagctcaaaagaaag
ttggccgaactagagaaatgggtccatgtgaatgctactgatcccaaatcggtggatgag
ctagaagatgaaattcttaatcaaaccgtgtcagccttgaatcccaacttatccaagaaa
tccgagaagcattcacaagatgatcaaacggccaaagatggcataattacattcattttc
accaaatcgattggatag

DBGET integrated database retrieval system