KEGG   Puccinia graminis: PGTG_02636Help
Entry
PGTG_02636        CDS       T02226                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pgr  Puccinia graminis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PGTG_02636
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGTG_02636
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PGTG_02636
Enzymes [BR:pgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PGTG_02636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 573 aa AA seqDB search
MEYISTRGGGESLTFEQTVLSGLAPDGGLYIPKRIPELPKDWESRWSQLSFTELALEIYS
LFIPSEEITRAELKELIERSYSTFRHPAIAPLKKLTPSRYVVELWHGPTFAFKDVALQFL
GNLFEFFLNRKNLNRPKDSPAERITVVGATSGDTGSAAIYGLRGKNDISIFILHPKGRVS
PIQEAQMTTVLDDNVFNLAVNGTFDDCQDIVKTLFNDTEFNSTYRLGAINSINWARILAQ
IVYYFSSYYALRHTLKPKQALQFVVPTGNFGDILAGFYAHKLGLPIGINGTTPGLVIATN
SNDILTRFWETGKYEKQASTDDEQSSPNHTTVQTAPVVGSSDGKQASDPKHGFVKETLSP
AMDILVSSNFERLLFYLAFDTLTESKDPEEERIKSSQAKVKEWMSQLKSTGRFRVPESTL
QAARALFSAGRVDDEQTKQTIRRYFNADKDVLEDGQRYVVDPHTAVGLFVAENLKPGGQE
EVLQAILSTAHPAKFAEAVTQSILTQQASSDHPPSSFDFERDVLPVQFIGLLDKPRRVID
VHGIEIQLTKDVIISHSNALISPSSNLDPTTSV
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggaatacatttctaccaggggaggtggtgaaagccttacatttgagcagacggtctta
tcaggattagcaccagacggaggactatacatccccaagcggataccagaattaccgaag
gactgggaatcgagatggtctcaattaagcttcaccgagcttgccctggagatctattcg
ttattcatcccgagcgaggagatcacacgtgcggaactgaaagagttgatcgagcgttcc
tacagcaccttccgccacccagccatcgccccgctgaagaagctgactccgagccgatac
gtggtcgagctttggcatgggccgacgttcgccttcaaggatgtcgctctccagttcctc
ggtaacctcttcgagttcttcctcaaccgcaagaacctcaacagacccaaagattctccc
gccgagaggatcaccgtcgtcggcgctaccagcggcgataccggtagcgcagctatctat
ggcctcagaggtaaaaatgatatctccatcttcatccttcatcctaagggccgcgtcagt
cctatccaggaggctcaaatgaccaccgttctcgacgataacgtcttcaacttggccgtc
aatggaacgtttgatgattgtcaagacatcgtcaagaccttatttaatgataccgagttc
aactcgacctaccgattaggggcaatcaactcgatcaattgggcccgaatccttgcccaa
atcgtctactatttctcctcctattatgcccttcgacacaccctgaaacccaagcaggcc
ttgcaattcgtcgtgcctacgggtaacttcggtgatatcctcgctggcttctatgcccat
aaactcggactacccatcggtatcaatgggactactcctggcctcgtgatcgctaccaat
tctaacgatatcttgactagattttgggaaactgggaagtacgaaaagcaagcttcgaca
gacgacgagcaatcttcaccaaatcatacgactgtccagactgcgcctgttgttggatcg
tccgatggcaaacaagctagtgatcccaagcatgggttcgtcaaggaaactcttagcccg
gcgatggatatcttggtctcgagtaacttcgaacgtctactattttacttggcttttgat
actttgaccgaatcgaaagacccagaagaagagcggatcaagtcttcacaagccaaggta
aaggaatggatgagccagttgaagagcaccggccgattccgagtgcctgagtcgaccctc
caggccgctcgcgccttgttctcggccggaagagtcgacgatgaacagaccaagcagacc
atccggcgctacttcaatgccgacaaagacgtgctcgaggatggccaacgatacgttgtc
gatcctcacactgccgtcggcctcttcgttgctgagaatcttaagccggggggtcaagag
gaggtgcttcaagcaatcctgtcaaccgcccatccggccaagttcgccgaagccgtcact
caatcgatcctcacccaacaagcttcgtccgaccatcccccatcttcgttcgattttgag
cgcgacgtcttgcccgtccagtttatcggactgctcgacaaacccaggagagtgatcgat
gttcatggaattgagatccagctcaccaaggacgtcatcatctcccattcgaatgctctc
attagtccttcctcaaatctcgatcctacgactagcgtttaa

DBGET integrated database retrieval system