KEGG   Puccinia graminis: PGTG_02695Help
Entry
PGTG_02695        CDS       T02226                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pgr  Puccinia graminis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PGTG_02695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 112 aa AA seqDB search
MGKKDSGGEGDPAIGGKLFGQRCATCHTVEKGAPHKVGPNLHGLFGRKTGQAAGYNYTEA
NVKKGITWSEETLMEYLIDPKKYIPGTKMAFAGLKKEKERANIVAYLKDATK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaaagattccggaggcgaaggcgacccagctatcggcggcaaactcttcgga
caacgatgtgctacatgtcacaccgtcgagaaaggcgctcctcacaaagtcggacccaac
ctacatggtcttttcggtcgtaagaccggacaagccgccggttacaactacacagaagcc
aatgtcaagaagggaatcacatggtccgaagagactcttatggagtacctgatcgacccc
aagaaatacattcctggaaccaagatggctttcgctggcttgaagaaggagaaagaacgt
gccaacatcgttgcgtacttgaaggacgccaccaaataa

DBGET integrated database retrieval system