KEGG   Puccinia graminis: PGTG_03326Help
Entry
PGTG_03326        CDS       T02226                                 

Definition
atypical/PIKK/FRAP protein kinase
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pgr  Puccinia graminis
Brite
Protein kinases [BR:pgr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   PGTG_03326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2357 aa AA seqDB search
MDRSIAPRPIEAILVDLKSRSDELRSRAAHEVQQFVLTSSRGVTGDSFTKVYNEVSGRIQ
IAVSSNDMNEKLGALQAMEKLIDIMGEDTTRAYKLVSYVQKVLPCQDPLVMGYAAKIFAR
LCSKGGNLMLENVRKQLVRVIEWLQGERKEERRHAAALLLREMVRVPPSSVIYDALPDLL
DNLWTAMRDPKVVIREVASDALAGLLCFTSTRESTTRDECFLMVLQQAQKGFKLGTSDAI
HGSLLGIKELILEGGTFMRPRFHEISDQILTYKDHREALVRRAVVELIPTLASYNSVEFS
STYLYQCMMYLIEQLRKDRDRTTSFYAIGHVAVAVKQQMSLYLEAVLASIKEALVNRGKK
NSPSEASIFHCISKCAAAVGQAMTKHMHELLELMFSNGLSEPLRAALVDLARFIPPLLPI
VQEKLLDLLAVTLSGEKFKPPGMPINWKAASSPADLSAMEADRATVTLALKTLGTFNFKG
HRLNEFVRDVVIRYADDESPDVRQAAATCCAQVLARDPIIHQNSSYAIKLISDVLTKLLA
VVIADPLPSIRQSTLLALDSKFDRFLAHPNNIKQLFIVLNDEVHVIRESAIKTIGRLAKR
NPAYIVPNLRKTLIQLLTDLEYSSDVRRKEESSNLLAHLISCSKSLTKPYVAPMLKVLLP
KARDSNPAVASSIMMALGELARVGGSEVSSQIGTIMQLIMDTLKDLSPGKREAALKTLGQ
LCSNTGYVVEPYFDEPTLLPIITSILKTETSSHVRREALRVLGILGALDPYRNTALDQFG
CSGIAIGIGSSLDLAPILTDPSHPDQIGSSNENYYPTVAFSALLSILSDSSLSHHHAAVV
QAIIYIFRSLRLKCVGFLPKVIPAYLSAMRLCNVALQEYYFQQLGYLIQMVKHHIRNHLP
SIITLIHEFWITATGGLNENGIVTVTRPSGSTLLTVIVDLIESIALALESEFRTYLPSFL
PLLIDSFDYSNTKYQTLNHILKAFQTFGNNLEDYIQLVLPCLIKTIEKPELPLSLRKNAI
ITLNVLSMKINLIDQVSRVIHPLIRVVNVGNNELRGLTMDAICSILIQIGPDFVIFLSTV
NHALTQARYSHPLYESLVLKLLKGETLPDPNFNKPQANVTVESDIAPDAGTTKFQVNQQN
LKSAWETSTVKKPKSEDWKEWIKRLSVQLLQSSPSHCLRACANLSSVYPPLARELFNAAF
VSCWMELFERYQVELVAAIQIALSSPTIPPEITQTLLNLAEFMEHDEKVLPIRISTLGMY
AQKCHAFAKALHYKEIEAFTEPTADTLDSLIQINQHLQQPDSAQGVLTMAQQRFGMEIRE
EWFEELERWEDALDSYTRKLEEDPKSIDAILGGMRCLHALGEWESLSEMAQDNWESSSNE
VKRTMAPLAAAAAWGLAQWDSMDSYINVLKSDSAEKAWFKSILSIHRGQHSVAQRLINKA
RDTLDTELSTLLGESYSRAYNLVVRVQMLSELEEIIAYKECKDDDPSKQEQIQRTWMKRL
KGCQRDVEVWQRILKVRALVLTPREDVGMWIKFAGLCRKSGRLGLAEKTLNSLMSEDIDN
GLESRGPPLVIYSHIKYMWGSGAKQDSLMYLKDFTLRLSEDVFDHRDQGGDQDFEQQSRR
VEHQRLLSRCHLKLGEWQSQLQEDWSSPAVADILESYRLSSELDPEWYKAWHAWALANSK
VASHYERNQDANSVPAEIVQYHLVPAVEAFFKSIALSPGNALQDILRLLGIWFKYGDHQV
VANAIQDGFGNVSIDTWLEVVPQLIARIHAPSANVRRLIHNILCDVGKAHPQALVYPLVV
ASKYPNEPRRKAALDIITKMKMHSALLIEQALLVSSELVRAAILWPEMWYEGLEEASRLF
YGDHNIDAMFATLEPLHDLLEKGPETIRESHFASTYGHDLMEARACCRRYRERGDVSDLN
QAWDLYYQVFRSIAKSLQMTHMLDMQTVSPPLLEARDLEIAVPGTYRSGKQVITIGFISP
ICKIMGSKQRPRELSIVGSEGRCYRFLLKGHEDLRQDERVMQLFGLINTLLSKDPETFKR
HLNIRRYAVIPLAPNSGLLAWIENTDTLHVLIKNYREGRKILLNIEARLMQQMAIDHERL
CLTQKVEVFEYAMDNTTGQDLYRVLWLKSRNSEAWLDRRINYSRSLAVMSMVGHVLGLGD
RHPSNLLLDRVTGMIIHVDFGDCFEVAMTREKWPEKIPFRLTRMLVQAMEISGVEGTFRI
TSENTMRVMRSNKESIMAVLEAFVHDPLINWRLVKGGRQLDEREGGATNQAGPRMRRPRE
VETNLYDTAQAEVLNDKALTVVNRVEQKLTGRDFKPSEELSVANQVNKLILKAVAAENLA
QCFTGWCPFWVDHGAGI
NT seq 7074 nt NT seq  +upstreamnt  +downstreamnt
atggatcgctcaatcgccccaagaccgatcgaagctatcctcgtcgatctcaaatctaga
tcagacgaacttcgctctcgtgcggctcatgaagtccaacaatttgtcctcacttcttct
cgaggagtaacgggtgactcgttcacgaaagtctacaacgaagttagcggccgaattcaa
atcgcagtctcatcaaatgacatgaacgaaaaattgggtgctctccaagcaatggagaaa
ctcatcgacatcatgggagaagataccaccagggcttataaactggtttcttacgttcag
aaagttttgccctgtcaagatccgttagtgatgggctacgcagccaaaatatttgcccgg
ctgtgctcgaaagggggcaatcttatgttggagaacgttcgaaaacaacttgttcgtgtg
attgaatggctacagggtgagcggaaagaagaacgacgacatgccgctgcccttctactt
cgagagatggttcgagtgcctccctcgagtgttatctacgatgctctgcccgatctactc
gataatctgtggactgcgatgcgtgatccgaaagtcgtgatccgagaagtggcatcagac
gctctagctggtttactttgcttcacctcaactcgtgaaagtaccacccgggatgaatgc
ttcttgatggttctacagcaggcccagaaaggcttcaaactaggcacttctgatgccatt
catggtagcttgctaggaatcaaagaattaatccttgaaggtggaactttcatgcgacct
cggtttcacgaaatctcggatcaaattctaacttataaagaccatcgagaagccctagtc
cgacgagcagtagtggaactaatacccaccctggcctcttacaactctgttgaattttct
tctacatatctctatcaatgtatgatgtatcttatcgagcaactacgcaaggaccgagat
cgcaccacctcattctacgcaatcggacacgtcgctgtcgccgtcaaacagcagatgtct
ttatatctcgaggccgtcctggcatctatcaaggaagctttagtcaatcggggcaaaaag
aacagtccttccgaagcctccatctttcattgtatcagcaagtgtgctgcagctgttggg
caagccatgaccaaacacatgcacgaattgctcgagttgatgttttccaacggtctcagc
gaacctctgagagcggcactggtcgatttggcacggttcatccctcctctattgcccatt
gtccaagagaagttgctcgacctgcttgcggtgacactttctggagaaaaattcaagcct
cctgggatgcctatcaattggaaggctgcatccagcccggctgatcttagtgccatggaa
gctgatcgagcgacagtcactctggctttaaaaactctgggcacattcaacttcaaaggg
cataggctgaatgaatttgtgagggatgttgtgattcgatatgcagatgacgagtccccc
gatgttcgacaggctgctgccacttgttgtgctcaagttttggctcgagatcctatcatc
catcaaaattcatcatatgctatcaagctaatctcggacgttctcacaaagctactggct
gtcgtgatcgccgatccattaccctcgattcggcagtctactctcttggccctagattcg
aaatttgatcgatttttggcccaccctaataatatcaaacaactattcattgtactgaat
gacgaagtccatgtcatcagggaatcggctatcaagacgattggacgccttgccaagcgc
aatccggcttatatcgtgcccaatctaaggaaaacgctaattcaacttttgactgacctc
gaatactccagtgatgtccggcgcaaggaagaaagttccaatctcctggcgcatcttatc
agctgttcgaaaagtctcaccaagccatatgtggcccccatgcttaaagtcttattgcca
aaggctcgcgattcaaatcctgcagtggcttcttcaatcatgatggctctgggtgagtta
gcgcgagtagggggatccgaggtgtccagccaaataggcactattatgcagttgattatg
gacacgttgaaagatctttcaccgggaaagcgggaagcagccctgaagacactcggtcag
ctctgctcaaatacgggctatgtggtcgagccttacttcgatgagccaacgctcttgcca
attatcacatcaattttaaagaccgaaacctcaagtcacgttcgtagggaggcgttgcga
gtcttaggaatcctgggcgctctagatccctacagaaacaccgcgttagatcaatttggc
tgtagtgggatcgccattgggattggatcctctttagatttggcacctattctcaccgat
ccctctcatcctgaccagatcggttcttcaaatgagaactactatcccaccgtcgcattt
tcagccttgttatcaattctaagcgactcgagtttatcgcatcatcacgccgctgtcgtc
caggcaatcatttacatatttcgctcgcttagattgaagtgtgttggctttcttcccaaa
gtcatcccagcatatctaagtgctatgcgtctatgtaatgtggctctacaggagtattat
tttcaacaactaggttatttaattcaaatggtcaaacatcacatcaggaatcacctccct
tccatcatcactctgatccacgagttttggattaccgcaaccggtggactgaatgaaaat
ggtattgtcaccgtcactcggccaagcggctcgacactactgacggtcattgtggatctg
atcgagtcgatagccctggcgctggagagcgagttccggacgtacctaccttcattcttg
ccgcttcttatcgactcttttgattacagcaatacgaaataccaaactcttaaccacatc
ctgaaggcttttcagacatttggcaacaacttggaagattacatccaattagtgttaccc
tgcctcatcaagacgatcgaaaaacccgagttgccactgagcttaaggaagaacgcgatc
attaccttgaatgtgttgagtatgaaaatcaatttgatcgatcaagtctcgagagttatt
caccctttgatcagagtggtcaatgtgggtaataatgagttgaggggcttgacgatggat
gcgatctgcagtatcctgattcagattgggcctgactttgtgatcttcttgtcaacagtc
aatcatgccttgactcaagcaagatactcacacccattgtacgaatcgctggtcttgaaa
ttgctgaagggtgagactttgcccgaccccaattttaacaaaccgcaggcgaatgtgaca
gtggagtcagacattgcaccagatgctggaacgaccaaattccaagtgaatcaacaaaac
ctgaagtctgcttgggagacgtcgaccgttaaaaaaccaaaatctgaggactggaaagag
tggatcaaacggctctccgttcaattgttacaatcatccccgagtcattgtctgagggct
tgtgcgaatctatctagtgtttatccgcccctagctagagagctcttcaatgccgctttt
gtgtcttgctggatggagctattcgaacgataccaggttgaattggttgcagccattcaa
atcgcgctctcttcgccgacaatccctcctgaaattactcagaccctcttaaacttggca
gaatttatggaacatgacgaaaaggttttgccgatccggattagtaccctgggcatgtac
gcccaaaagtgccatgcatttgcgaaagcgttgcattacaaggaaatagaagcattcaca
gaacccacagcggacacattggacagtctgattcagatcaatcagcatttgcaacaacca
gattcggcacaaggagtactgacgatggctcaacagcgttttggaatggaaatccgagag
gaatggtttgaggagcttgaacggtgggaggatgcattggacagttacaccagaaagcta
gaagaagatcccaagtcaattgatgccatcttaggtgggatgaggtgtctacatgcgctt
ggagaatgggaatccttgtcggaaatggcccaggataactgggagagctcgtccaacgag
gtcaaacgaaccatggcaccattggcggctgcggctgcatggggattggcacaatgggat
agtatggatagttacatcaatgtattgaaatctgattcggctgaaaaggcttggtttaaa
tccatcctttccatccaccgcggtcaacattcagtggctcagagacttatcaacaaagct
cgtgacacgttagacactgagctctcgaccctcttgggcgaaagttacagtcgtgcctac
aatctcgttgtcagggttcaaatgctttcggagctcgaagaaatcatagcctacaaggaa
tgtaaggatgatgacccaagtaaacaggagcagatccagcggacttggatgaagcggtta
aaaggctgccaacgtgatgttgaagtttggcagagaatcttgaaagtcagagccttagtg
ttgacacctcgagaagacgttggaatgtggatcaagttcgctgggctgtgtcggaagtcc
ggaaggctaggacttgctgagaaaacgctgaattccttgatgagtgaagatattgataat
ggtcttgaatcgcgtggtccaccgttggtgatatactcgcacatcaaatatatgtggggg
tcaggagcgaaacaagacagtttgatgtacctcaaagattttacacttcgattgagtgag
gacgtcttcgatcaccgagatcaaggtggtgatcaagatttcgagcaacagagtcgaaga
gttgagcatcaaagattgctatctcgttgtcatcttaaacttggtgaatggcaatcccaa
cttcaagaagattggagctcaccggcggttgcagacattctagaatcttacagactttca
tcagaactcgatccggagtggtataaagcttggcatgcatgggccttagcaaattcaaag
gtggcctcccattacgaacgcaatcaggatgccaactcggtcccagctgagatcgtccaa
taccacttagtcccggccgttgaagcgttcttcaagtcaattgctctgtcacccgggaat
gcgcttcaagatatcctgagattgctagggatttggttcaagtacggcgatcaccaagta
gtcgccaatgccattcaagacggtttcggtaacgttagtatcgacacctggttagaggtg
gtccctcagttaatcgcacggatccatgctccaagtgccaacgttcgacgtctcatccac
aacatcttatgcgatgtgggtaaagcccaccctcaagcattagtatacccgttggtagtg
gcctcgaaataccccaatgaacctaggaggaaagcagcactcgacatcatcaccaaaatg
aagatgcacagtgcccttctaattgaacaggccttgttggtcagtagtgagctagtcaga
gcggcaatcttgtggcctgagatgtggtatgagggtttggaagaggcgtccagattgttt
tacggagatcataatatcgacgcaatgtttgccactttggagccgctacatgacctattg
gaaaagggccctgaaacgattcgggaatcacactttgcatcgacttatggtcacgatttg
atggaagctcgtgcttgttgtcggaggtacagagagcgaggggatgtgagcgacctcaat
caggcatgggatctatactaccaagtcttccgaagtattgccaaatctcttcaaatgacc
catatgctcgacatgcaaactgtctcgccacccttactggaagctcgcgatttggaaatt
gctgttccgggcacttaccgcagtggcaaacaagttatcactatcggatttatctcaccg
atctgtaagatcatgggatctaaacaaaggcctcgagagctgtcgattgttggcagtgaa
ggtcgatgttaccgattcttattgaaaggacatgaagacttgagacaagatgaacgagtg
atgcaattgtttggattgatcaatactctcctttcgaaggatcccgaaactttcaagagg
caccttaacattcgtcgatatgccgtcattcccttggctcctaattctggcttgttggct
tggatcgaaaatactgatacgctgcatgtgttgatcaagaattatcgggaaggtcgaaag
attctgctaaacattgaagcacgattaatgcaacagatggcgatcgatcatgaacgattg
tgcttgacacaaaaagtcgaagtgttcgagtatgcaatggataatacaaccgggcaagat
ttgtatcgggtgttgtggctgaagagcaggaactctgaagcttggttggatcgacgaatc
aattactctcgatctttggctgtgatgtcaatggttggacacgtattgggcttgggagat
cggcatccatctaacttgctcttggaccgagtgactggaatgatcatacatgtcgatttc
ggagattgttttgaagttgctatgacacgagaaaaatggcccgaaaagatacccttcagg
ttgacaagaatgttagtccaagcgatggagattagtggggtcgaagggaccttccgaatc
accagtgagaatacgatgcgggtgatgaggtcgaacaaagaaagtatcatggctgtcttg
gaggctttcgtacatgatcctctgatcaattggaggttggtcaaaggtggaaggcaactg
gatgagcgagaaggaggtgcaactaaccaggcaggccctcggatgcgtcgaccgagagag
gttgaaactaacctatacgataccgcccaagccgaagtgctcaatgataaagcgctgacg
gtcgtcaatcgagtcgaacaaaagctcacagggagagatttcaagcccagcgaagagttg
agtgtggccaatcaggtcaataaactgatcctcaaagctgttgcggccgagaatttggct
caatgtttcaccgggtggtgtccattctgggtagaccatggcgctggtatctag

DBGET integrated database retrieval system