KEGG   Puccinia graminis: PGTG_03488Help
Entry
PGTG_03488        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
pgr  Puccinia graminis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1573 aa AA seqDB search
MLPRDPKLPADVFTSCLTSPIEMALRFYVLRNNSQRSQWTSTAEFFQDLGKLDKVPGRME
MRRTPLGELTWIFTSIADAIAWNHLDRQTFTKIFRGDLVLAGTFRGFLLAERVMKAYGCT
PMSTPKLPATHHSELWHTWDLEVDMCLSQLPGIWKSEEARAVYEKNKQNYPPNSLPPQIV
PYMPSTFFSQQLTAFEVWLKFVVAENQDESGEKDEDLMKRRESLQWSCNNWSDVNINQVE
ITDFSCSNPNSQTSPKDKRASVKVNGKTPHLAGKSSGSHASPASGAPKAVKIPEQQPAER
PIRYKLPTHIKHFPLNSRKGDDIYPPSPPQLPIVLQVLLSPVHRLRALILLCRLMDLGPW
AVHLSLSIGIFQYVLKLLQAPAADLKPVLIFIWARILTVYPEGRQDLMRVASRPHARPEG
PIEYFIKIMAPNSMELPIVNVVDHKAMCAFILSITCQNSRGNSLALMQFGVLDIIIYRIK
ELVPWQRQWYLILLAHMWEESDLVKGRAIKMGINTLLSDLLTDKVPEVRTAALYAFGTLI
GVSTNPKQLVIEDQFPIIPGQTEERQPESSSSRPQNKSNPSVYQTNKLSSLSSSNPDLTV
LGYQEQVSIEVGSAMACCHCSTDGSPMFRQELVVVLSALVDQHLGHFIVAAFEFIKQQEQ
EKSMKINKLIQKYQADRQQKSSSKQTALGADESHMMTDRTAKLEKLINKLKADEEVHPKE
SLRAYLWMEYTSIYIVLLDLSLDPSEQVARPAKVVVDYIHSRLLDSVLGKLLELGDLSYG
EAPGGGVDGTGQLSETPLGRLGNHSHSNLIASSFASTSSNPTGREPKSSNQSLVNRSSTS
VFHSLSTVNNLVPNFVKSSGWKTPFNSLSRSPEQAVFNSNDPVASTLTQSPQDLNKSASG
LRKSASVNPIINVELDSPQSSQPSKMPLNHNGFSHASSTSSSQTQCSTEDDRHLQGLSTN
QSIESIIAHTRASDHTRRQRNRSYPLQPAFPSAASPSYQPGKMNASTSTTSPVANPSHQE
DGEEENYLYYLGLHNLEKLKAELNSRPEPSERQTMLPLMSDYYRLSSHIFLKPKMTSSGG
ESESESSDSDNNDDHDNDQPQVFNEKAEYTEQRPPTHQSHHPRAPNHQNTVVDDAALSHI
SHPHHFHPPHHHHIDAGSLENIKDSWRKQRNLRVILDGPTLKSNPGPNNWDHLVCSFNHS
KPINNLLMHQFEDQLITSDSSGYITVYDWRSKSILNRFQPSDDPLDRITSMQLINQENVA
LLLASTPDGNVRIFRDYERPGKLAMVTAFKGLPNNEPSSLGESGSVTDWQQSTGLLLVGG
NSRDIKVWNSRRERCVEDIKTRSNSCLTSLSSDHHSGWMIAAGFGDGSVRMFDRRKPPKN
SMVKVFRSVHSSWCSKIKLQAGHRRELFSADSTGLIAQWDLRFDSPLRTFLAHEEGMPAF
DLHDHAPILASGSMNGSVKIWNLDNGNDENDEEFTVERAPRVLFNLRNLYESTDAQDPQG
SNTLSGFPSTSITSPLMGDYGHRLRGIGIGNPLRDALSSLQPITGLCFHPHRAMISITDG
NGKLNIYSTDIKL
NT seq 4722 nt NT seq  +upstreamnt  +downstreamnt
atgttaccacgtgatcccaaattacctgcggatgtgttcacctcttgtttgacctccccg
atcgaaatggccctgaggttctatgtccttcgaaacaactcgcaacgttctcaatggact
tcaactgcagaattcttccaagatcttggtaaacttgataaagttccaggccggatggag
atgcgtcggacaccactcggtgaactcacctggattttcacctcgatcgccgatgccatc
gcatggaatcatctcgatcgtcaaactttcaccaaaatctttcgcggtgatctggtcttg
gctggtacctttcgagggttccttttggcagaaagagtcatgaaagcctatggctgtaca
cccatgtcaactccaaagctacccgcaacccaccactctgaattatggcacacttgggat
cttgaagtcgacatgtgtctatcacagttacctgggatttggaaatccgaggaggcacga
gcggtctatgagaaaaacaaacaaaattaccccccaaactcgctcccccctcagatcgtc
ccttacatgccatcgacattcttttcacaacaacttactgcattcgaagtttggctcaaa
tttgtcgtagctgaaaatcaggatgagagcggtgaaaaagacgaggatctgatgaagaga
cgagaatccctccagtggagctgcaacaactggtctgatgtgaatattaaccaagtcgag
atcaccgatttttcttgttcaaatccaaactcacagactagtcccaaggataaacgcgcc
tcagtcaaagtgaatgggaaaactcctcatttggctggcaagtcgtctgggtcacatgct
tcccctgcttcaggtgcccccaaagccgtcaagattcctgagcaacaaccagctgaaaga
ccaattcgatacaaattgccgactcacatcaagcatttcccactcaactcgcgcaaagga
gatgacatctacccaccctctccacctcagctgccgatcgtactacaagtccttctatcc
cccgttcatcgattgcgagcactaatcttactttgccgacttatggaccttggtccctgg
gccgttcacctttccctatcgattggtatattccagtatgtcttgaagcttcttcaagct
ccagctgccgacttgaaaccggtcttgatttttatttgggcgaggatcttgactgtttat
ccagagggaaggcaagacttgatgagagttgcttcgcgaccccatgctcgtccagaaggg
cccattgagtatttcatcaagatcatggcccccaacagcatggaactacctatcgtcaac
gtcgttgaccataaggcgatgtgtgctttcattctctctattacctgccagaattcacgg
ggcaattcacttgccttgatgcaattcggcgttttggatatcatcatataccgaatcaag
gaacttgtaccatggcagagacagtggtatttgattcttctagcgcacatgtgggaggaa
tcggacctcgttaaaggacgtgcgatcaagatgggaatcaacactttactgagtgacttg
ttgaccgacaaagtacccgaggttaggacggctgctctctatgcgtttggcactctgatc
ggggtctcgacgaatccaaaacaacttgtgattgaagaccagtttcccatcataccaggc
cagactgaggaaagacaacccgaatcgagctctagtcgacctcagaataaatcaaatccg
tcggtttaccagaccaacaagttgagcagtttgagctccagtaatccggatctcactgtg
ttgggatatcaagagcaggtttccatcgaagtgggtagcgcgatggcttgttgtcactgt
tcaaccgatggatctcccatgttccgtcaagagttggtcgttgtactcagcgcattagtt
gatcagcatctcggacactttatcgttgctgcttttgagtttatcaagcagcaggaacaa
gaaaagtcaatgaagatcaataagctcattcaaaaatatcaagccgatcgccaacaaaaa
tcatcaagcaaacaaactgcacttggagctgatgaaagtcacatgatgactgatcggact
gcgaagctcgaaaagttgatcaacaagttgaaagctgatgaggaagttcaccccaaggaa
tctttacgcgcgtatttgtggatggagtatactagtatctacatcgtcttactcgatttg
agtttggatccctctgagcaggttgcacgcccagccaaggtagtagttgattatattcat
tctagattactagacagcgtattaggaaaattattagaattgggtgacttgagctacgga
gaagcccccgggggcggggtggatggtactgggcaattgtcagaaacgccgctgggaagg
cttggcaatcatagccattccaatctcattgcgtcctcatttgcttcaacgagttctaac
ccgaccggccgagaaccgaaaagtagtaatcagagccttgtcaatcggtcttctacttct
gtgtttcattccctgagtacagtcaacaatctcgtgccgaattttgtcaagtcatctggt
tggaaaactccattcaattccctcagtcgatcccctgagcaggccgtattcaattcaaac
gatccagttgcttcgacattaactcaatcgccacaggatctcaacaaatccgccagtggc
ttacgaaagtcagcgtcggtaaacccaatcatcaacgtcgaactcgatagtccccagtca
agccagccatcaaagatgccgctgaaccacaatggattctcccatgcctcatctacttct
tcgtctcaaacccagtgtagcacggaagatgatcgacatcttcagggcctctcgactaac
cagtcgatcgaatccatcattgctcacacgcgtgcctctgatcatacccgtcgacaacgc
aatcgttcttaccccctccaacccgcattcccctcggccgcaagtccgagctatcaaccc
ggcaaaatgaacgctagcacttccactacttcacccgtagccaatccttcccaccaggaa
gatggcgaggaagagaattatctctactatctgggattacacaacctcgagaaactgaaa
gctgaattgaatagtcgaccagaaccaagcgagcgacaaacgatgctgccattgatgtca
gattattatcgattgagttcgcacatcttcttgaaacccaagatgacgagctccggagga
gaatcggaatcggaatcttcggactctgataataatgatgaccatgataatgatcaaccc
caagtctttaacgagaaggccgagtacaccgagcagcgaccacccactcaccagtctcat
catcccagagcccccaaccatcagaacactgtggtcgacgatgccgccctctctcacatc
agtcatccccatcactttcatcctccccatcatcatcatatcgacgctggtagcctcgaa
aatatcaaagactcttggagaaaacaacgcaacctcagagtcatcctcgatgggcctact
ttaaaatccaatcctggtccaaacaattgggatcacttggtttgctccttcaatcattcg
aaaccgatcaataatcttttgatgcatcaattcgaagatcaattgattacttcagattcc
agtggctatatcacggtttatgattggcgttcaaaatcgattctcaatcgatttcaaccc
tctgatgatccgcttgatcgaataactagtatgcaattgatcaatcaggaaaatgtggcg
ttattactggctagtactcctgatggaaatgtgagaatatttcgagattacgagcggcct
gggaagttggcaatggtgacggcattcaaaggattaccaaacaatgaaccgagcagtctc
ggagaatcggggagtgtaactgattggcaacaaagcacgggcttgctgctagtcggtggg
aattcgcgggacatcaaggtgtggaattctcggcgagagaggtgtgtggaggatatcaag
acgcggtcgaacagttgcttgacgagtctgagttcggaccatcattcgggctggatgatt
gcggccggcttcggcgacggctcagtgaggatgttcgatcgacgcaagccgccgaaaaac
tcgatggtcaaggtcttcagatccgtccactcttcttggtgctctaaaatcaagctccag
gccggccatcgtagagaactcttctctgccgactccaccggcttaatcgctcagtgggac
ttgcgcttcgattccccactcagaaccttcctggctcatgaggaaggcatgcccgccttt
gatctacatgaccatgcccccattttagctagtggctcgatgaatggaagtgttaagatc
tggaatttggacaatggtaatgatgaaaatgatgaagagttcacagtagaacgggcgccc
cgagtgcttttcaatctccgaaacttgtacgaatcgacggatgctcaagatccacagggg
tcgaacaccctctcgggattcccgagcacttcgatcacgtcccccttgatgggcgactat
gggcatagactcaggggcatcggaattgggaacccgcttcgtgatgcgttgtctagtctt
cagccgatcaccgggctctgctttcatccacatcgggctatgatctcgatcaccgatgga
aacgggaaacttaacatctattccaccgatatcaaattgtaa

DBGET integrated database retrieval system