KEGG   Puccinia graminis: PGTG_03906Help
Entry
PGTG_03906        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
pgr  Puccinia graminis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PGTG_03906
  Replication and repair
   03420 Nucleotide excision repair
    PGTG_03906
Transcription machinery [BR:pgr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PGTG_03906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 353 aa AA seqDB search
MNIRNKTEPTQPQPLYQLSTQYRHWRFSQSGLEQARRELNEGAVGRVKSKLEEERNVELP
SAGDEPTEPSQIEYLTVQDELELVTFYLSKISQLCRASIFNFPETVEATAMSYLKRFYLR
NTCMDYHPKNIMLTCLFLATKTENTSISIDSFASRIPKTTNGDVLALEFLVAQSLKFQFK
VHHAHLAARGIYLDLQACPGVGPLGLERLSQAWPEVCALLRTGRLTDAEFLWTPSQIACA
AWWVADRSATEAWLKAKADRLQPSPTDIPSTCLGLDPLTQYLQSLSELLIQAQRKPIDKD
RVTAVDRRLRFCRNPEKDPNSALFKIKQAELEHAHLAKHHQKYPPNSNQDPFS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaggaacaagaccgaaccaactcaaccacagccactctaccaactatcaact
cagtatcgtcattggcgattctctcagtcaggactcgaacaggccagaagagaactcaac
gaaggcgccgtcggaagagtgaaatctaagctcgaagaagagaggaacgtcgagctccct
tcagccggtgatgagccaaccgaacccagtcagatcgaatatctgaccgtccaagatgaa
ctcgaactggtgaccttctacctctccaagatctcacagctctgtcgggcttcgatcttc
aactttcccgagaccgtcgaggcgaccgcgatgagctacttgaaacgcttctacctcagg
aacacctgcatggattatcatcccaaaaatatcatgcttacttgtctctttttggccacc
aagactgagaacacctcgatctcgatcgacagctttgcctcccggatcccaaagacgacc
aacggggatgtcctggcgctcgagttcctggtcgcccagtcgctgaagttccagttcaaa
gtccaccatgcccatctggccgcgcgggggatctatctggacctgcaggcctgtccgggc
gtcggtccgctcggcttggagcgactctcccaggcctggcccgaggtctgcgcgctgctc
cggacgggcagactgacggatgccgagttcctctggacgcccagtcagatcgcctgtgcg
gcctggtgggttgccgatcggtcggccaccgaggcctggctcaaagccaaggccgaccgt
ctccaaccgtcccctactgacatcccctcaacctgcttgggcttggatccactcacccaa
taccttcaatcgctctccgaactcctcatccaggctcagcggaaacccatcgataaggat
cgcgtcaccgcagtcgatcgcagactccgcttctgtcgtaaccctgagaaagaccctaat
agcgcactctttaagatcaaacaggccgaactcgaacatgctcatctcgctaaacatcat
cagaaatatccccctaattctaatcaagacccgttctcttga

DBGET integrated database retrieval system