KEGG   Puccinia graminis: PGTG_03910Help
Entry
PGTG_03910        CDS       T02226                                 

Definition
nitrate reductase (NADH)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pgr  Puccinia graminis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pgr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 288 aa AA seqDB search
MVSQLIQSNQSMLTILAILLAALLTIRFIRSSTTKPKPALVSNQFQHFKLHSKNEVSPNT
AIYRFALASQDDYLGLPIGQHIVIQAEIGGKQIQRMYTPVSSDDDRGYFELMIKTYEQGN
ISKYISKLRIGDPIQVKGPRGQMRYHPELCSQIGMIAGGTGITPMLQIIRASVKDSNDKT
KISLIYANVNPEDILLKQELDRIQNDHPKRFSVYYVLNNPPEGWTGGAGFVTKEMIESKL
PPSKLTKQVKILLCGPPPMMSIMKKYLEELEFEKCRVISKLDDQVFCF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggtcagccaactcatccaatccaaccagtccatgctcaccatcctcgccatcctacta
gcagcactactgaccatcagattcattcgttcatcaacaacaaaacctaaaccagcccta
gtctcaaaccaattccaacacttcaaacttcattccaagaacgaagtctcgccgaacact
gcaatctatcgattcgcattggccagccaggatgactacctaggactacccatcggacaa
cacatcgtcatccaggccgagatcggcggcaaacagattcagaggatgtataccccagtc
tcaagcgacgacgatcgaggatacttcgaactgatgatcaagacttacgaacagggtaac
atctcaaaatatatatcaaaactcaggatcggcgatccgatccaggtcaaaggacccagg
ggacagatgagataccatcctgaactatgctctcagatcggcatgatcgccggtgggacg
ggaatcacacccatgctgcaaatcatcagggcttccgtcaaggactcgaacgataagacc
aagatctcactgatctatgccaacgtcaacccagaagatatcctcctcaaacaagaacta
gatcggatccagaacgatcatccgaagcgattctcagtctactacgtcctcaataaccct
cccgaaggttggaccggcggggcaggctttgtgacgaaggagatgatcgagagcaaactg
ccgccatccaagctgaccaagcaggtcaagatcctcctctgtggtcctcccccgatgatg
tcgatcatgaagaagtatctggaggaactcgagtttgagaagtgtagagtgatcagtaaa
ttggacgatcaagtgttttgcttttga

DBGET integrated database retrieval system