KEGG   Puccinia graminis: PGTG_03918Help
Entry
PGTG_03918        CDS       T02226                                 

Definition
CMGC/DYRK/YAK protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PGTG_03918
Protein kinases [BR:pgr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   PGTG_03918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 874 aa AA seqDB search
MNLPANNINNSNQQQQQQQQQQQHQYYTNNTNYHQNLNQSSSHSSSQAPSTEQYYGSRSA
SRTSSHPQHPSATQTDQIGFRRLIPGSAHLFPILHDTPVERRVNPYDGTFISPLSALTIH
LADTYRLVNPAFRYELSLNPRRVLTKPSKPAGNNGLDNEDSDYILYVNDILGGSPSSTTT
DPNQLQLLQQQQHQQQQQDPNHQIRSIRSSASHKYLILDVLGQGTFGQVVKCQDMKTHQV
VAVKVVKNKQAYFSQSMMEVTILELLNNTWDPENKHHILRMKDTFIHHNHLCLVFELLSS
NLYELIKQNSFRGLSTSLVRVFTNQLLDALTVLNEAHLIHCDLKPENILLTSLSSPEIKV
IDFGSACHERQTVYTYIQSRFYRSPEVILGLPYSSAIDMWSLGCICVELFLGLPLFPGTS
EYNQITRIVEMLGMPPSYMLDVGRQTTQFFDVIEDTFNGARKVYKLKSLEQYSKEHNVAE
QPSKRYFQQNTLEDIISQYPVIRKGMKPADLEKEKQNRIAFIDFVKGLLNINPIERWSPQ
QARLHPFILGEPLREPYIPMKSGFVSNPGGDRVMELAQKGYGHSPIDPQASPQTAGGAGS
NDLSKRPYGGLPAAPVRSGQKVYDAAAYSQLQAQQQVINAQAAAMRQHQVQAAQQSQNPY
ALPQDNRSNLTQLPPQSNHQQQPPNSAPALTHQLPPQYASNRVALSHPPQPTSLATSSSA
AINIPHSYYSTRGAGGSGFSGPLTTGSIAGPQMQPLMSHNQMIYNPILNPSGSTNPSSHV
RTSSGSRQRSGTLDQMDIVPPQLQKVQVDLANYSGQSVTPVLRRDDQYLAWEQRQQHGIG
AANSTGIPGNSGLTRRASYRANPQLDYLHEQTYF
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgaacctaccagcgaataacatcaacaactcaaaccaacaacaacaacaacaacaacaa
caacaacaacatcagtactacaccaacaacaccaactatcatcaaaacctaaaccagtcc
tcatctcactcctcatctcaagcaccctcaaccgaacagtactatggatcccgatcagct
agcagaacctcaagccatccacagcacccatcagcaactcaaaccgatcagatcggattc
agaagactcatcccaggctcagcccacctcttcccaatcctacacgacactcctgtcgag
cgcagggtaaacccatacgacggtacattcatctcccccctcagtgctctgaccatccat
ctagcggatacctacagactcgtcaacccagcattccgctacgaactcagtctgaaccca
aggagagtactcaccaaaccatccaaaccggcgggtaataacggattagataacgaagac
tctgattatattctatacgtcaacgatatcctaggcggcagtccttcctcaacaacaacc
gatccaaaccaattacaactactccagcagcagcaacaccagcagcagcaacaggatcca
aaccatcagatcagatcaatcagatcatcagccagtcacaagtatctgatcttagacgta
ctcggccagggcactttcggccaggtcgtcaaatgtcaagatatgaagactcaccaagtg
gtcgccgtcaaggtcgtcaagaataaacaggcttacttcagtcagagtatgatggaggtt
accatcctagaattactcaataacacctgggatcctgagaacaaacatcacatccttcga
atgaaggataccttcattcaccacaaccatctctgtctagtcttcgaactactctcctca
aacctatacgaactcatcaaacagaactcattcagaggactcagtaccagtctcgtcaga
gtattcaccaaccaactactcgatgcattaactgtcctcaacgaggctcatctcatccac
tgcgatctcaaaccagagaacatcctattaacctcgctctcatccccagagatcaaagtc
atcgactttggttcggcctgtcacgaacgtcaaaccgtctatacttacatccaatccagg
ttttatcgttctcctgaagtcatcttgggcctaccttactcgtctgcaatcgacatgtgg
tcattgggttgtatatgtgtcgagctctttttgggtttaccgttgtttcccggaacatct
gaatataaccagatcacgaggattgttgaaatgctgggaatgccgccttcgtatatgctg
gacgttggacgacaaaccactcaattttttgacgtgatcgaagacacttttaacggcgct
cgaaaggtctacaagctcaaaagcttggaacaatattccaaggagcacaatgttgccgag
caacctagcaagcgatactttcaacaaaacacactagaagacatcatcagtcaatatccg
gtgattcgcaaaggcatgaaaccagccgatctcgagaaagaaaagcaaaaccggattgct
ttcattgactttgttaaaggtcttctgaacatcaatccaatcgaaaggtggtctcctcag
caagctcggttacatccttttatcttgggggaacctcttcgcgagccctatatccctatg
aagtctggatttgtttcaaatcctggaggtgatagagtcatggagctcgcccaaaaaggg
tatggccactcacccatagacccccaagcttctccccaaaccgctggtggcgctggctca
aacgatctgtccaaacgtccttacggtggcctccctgcggcacctgtccgatccggacaa
aaggtttatgatgccgccgcctactcccaactacaagcccagcagcaagtcatcaacgca
caggcagccgcaatgcgtcaacatcaggtccaagctgctcagcaaagtcagaatccctat
gcgctacctcaggacaatcgttccaatcttactcaactacctccccaatcaaatcatcag
caacaacccccaaactccgcacctgcccttacgcatcaactaccacctcaatacgcttcc
aatcgtgtggcactgtctcacccacctcaacctacctccctcgccaccagctcatcagct
gccataaacatcccacattcttactatagtacacgcggggctggtggtagtggattctca
ggaccattgacaacgggtagcatagctggtcctcaaatgcaaccgctcatgtcacacaat
caaatgatttacaacccgatcctcaacccgagtggatcgaccaatccttccagtcacgtc
cgaacttcttcaggctctcgacaacggtccggaacgctagatcagatggacattgtccct
ccccagttacaaaaggtccaagtcgatctggccaattattctggacagagcgtcaccccc
gtcctcaggcgggacgaccaatatctggcctgggagcagagacaacaacacggcattggc
gctgcgaattcgactgggattcccgggaatagtggcctcactcgtagggctagctatcgg
gcgaaccctcaattggattatttgcacgagcagacttacttttga

DBGET integrated database retrieval system