KEGG   Puccinia graminis: PGTG_04059Help
Entry
PGTG_04059        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pgr  Puccinia graminis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PGTG_04059
Enzymes [BR:pgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PGTG_04059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 266 aa AA seqDB search
MNRFSFRTAIGLLVSSSLLSNGVLAGLEDAKHSTKLDHTNFDAQIQVPEVGTLVAFFAPW
CGHCKSLLNPWDQASKAFETDSKCRIAHFDADASANRDIASRFSVSGFPTIKFLFKDKSK
AAIDYQEARSAEAIIKFLNKQCGTFRASGGLLLPEAGRVAGLDEIAKSFLGLSSEERPSI
IEKATELASSASEKMASYYVKVMNKLATDESWLSKESERLKKLAEKGATMASEKFEELQI
KQNILQAFMTVKEAGEHVVDKVTGEL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgattcagcttcaggaccgccatcgggctcttggtcagctcctcactcctgtcg
aatggtgtcctcgctggtttggaggatgctaaacattccactaagctcgatcataccaac
tttgatgctcaaattcaagtaccagaagttggaactcttgttgcatttttcgctccttgg
tgtggtcattgcaaaagtttactcaatccttgggaccaggcttccaaagcgtttgagaca
gactccaagtgtcgaatcgcccatttcgatgcggatgcttcagctaaccgagacatagcg
agccgattcagcgtatcaggatttccaaccatcaaatttttattcaaggataagagcaaa
gctgcaatcgactaccaggaagcccgatccgccgaagctatcatcaagtttctcaacaaa
cagtgcggtacattcagagcatcaggtggtctacttcttcccgaggccgggcgggtcgcc
ggtttggacgaaatagccaagtctttcctcggcctttccagcgaggaacggccttcgatc
atcgaaaaagcgaccgagcttgcctcatctgcctccgaaaagatggcctcctattacgtg
aaggtgatgaacaagttggcaactgacgaatcctggctcagcaaggagtccgagcgtctg
aagaagctggctgagaagggagctaccatggcaagtgaaaagttcgaggagcttcaaatt
aagcaaaacatcttgcaagctttcatgacagtcaaagaggccggagaacatgtggttgac
aaggttactggggaactatag

DBGET integrated database retrieval system