KEGG   Puccinia graminis: PGTG_04104Help
Entry
PGTG_04104        CDS       T02226                                 

Definition
clathrin, heavy polypeptide
Orthology
K04646  
clathrin heavy chain
Organism
pgr  Puccinia graminis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PGTG_04104
Exosome [BR:pgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   PGTG_04104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1704 aa AA seqDB search
MAEQRPISFCEHVQLTALGVQPASIGFNTLTMESERYVCVREEVNGAKQVIIIDLSDANN
VMRRPISAESAIMHPVQKVIALRAQRQLQVFNIELKQKVKSHAMNEDVSFWKWINDSTLG
IVTETAVYHWAALDPTSPPVKVFDRNANLAGHQIINYRASPDEKWMVLVGITGNPSNPSA
FKVKGSMQLYNKDRAVSQSIEGHAASFADYRLEGAASDSKLFAFAVRTAAGAKLHIVEID
HQAGQPVFAKKAVDVFFPPEATNDFPVAMQVSKKHKIIYMVTKYGFIHLYDVETAACIYM
NRISGETIFVTAEHETSSGIIGVNRKGQVLSVTVDEETIVPFILNTLKNPELAIKLASRA
DLPGADDIYIQQFQQLFSSGQFSEAAKVAANSPRGILRTPQTIEQFKGVPMQPGQLSPIL
QYFGILLERGKLNQTESLELARPVLVQGRKQLLEKWLKEDKLDCSEELGDIVRAHDMTLA
LSVYLRANIPNKVCACFAETGQSNKIVVYAKRVGFTPDYASLLQHITRLNPDSGAEFATS
LINDESGPLVDVERVVDIFMAQNMIQQATSFLLDALKENRPEQGYLQTKLLEMNLLNAPQ
VADAILGNEMFSHYDRPSIANLCEKAGLLQRALEHYEDISDIKRVLVHTNLLNPDWLVNY
FGKLTVDQTVDCFCEMLKVNIRQNLQIVVQGATKYSDLVGPVRLIEMFESFKTFEGLYYY
LGSIVNLSTDPEVHFKYIQAATRTGQIREVERICRESNYYPPEKVKNFLKEAKLTDQLPL
IIVCDRFDFVHDLVLFLYQNGLTSFIEVYVQKVNSQRAPQVIGGLLDVDADEMMIKNLLA
SVTGPIPVDELVEEVEKRNRLKLILPWLEARIAMGITDVGLYNAMAKILIDSNQNPEAFL
KENTIYDPLTIGKYCEKRDPTLAYIAYARGFCDEDLVRITNENSMFKQQARYLVKRRQLE
LWAQVLQPDNMHRRQLVDQVVSTAVPESQNPEDVSVTVKAFLAADLPIELIELLEKIVLE
PSAFSDNANLKKLLLLTAIRSEKGKVMGYIDKLEGIDVSEIAGIAIEHELFEEAFTLFRK
HKMHLEAMNVLVEHVVSIDRAAQYATKVNEPAVWSRLGKAQLDGLRIKDAIDSYIKAEDP
TNYLELIETADRAGKHDDMVRYLQMARKTLREPKIDTELCVAYAKTDRLHDMEEFLSMSN
VADQLSAGEQVFEAGLYEAARLLFSAISNWARLATTLIYLGDNQAAVDCARKAGNTQVWK
QVNSACVDKKEFRLAQVCGLNLVVHAEELQSLVKLYETRGYFEELMQLLEAGLGLERAHM
GMFTELSILYAKHKPSKLMEHLKLFWSRINIPKVIRATEQAHLWPELVFLYIHYDEFDNA
VLAMMERSADAWDHGQFKDIIVKVANVELYYKALSFYLQEQPTLLTDLLTVLVPRIDHTR
VVKMFQKTDNLPLIKPYLIAVQHLDLPAINEAYHDLLIEEEDYATLRDSLSNHENFDQVS
LAKRLENHELLEFRRLAALLYAKNAKFEESISLSKKDQLFKDAMITAASSASNEIVEELL
EYFVKVGNKECFAACLYICYDLIRPDVVEDLQWRYALNDYTMPYRLQQMREQTNRIEQIE
RQLKELSLRSAKAVEETESKPIIGPGFGGRLMLTQGPSNGMMGGQPTGAPSGYGGTGGMM
GGMQAQPTGMMGQQFTGMPGMMGF
NT seq 5115 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaacggccaatctcattctgcgaacatgtccaactcactgccctcggcgtc
cagccagcctccatcggcttcaacacgcttaccatggaatcggaacgttatgtgtgtgtt
cgtgaagaagtcaatggcgcaaaacaagtgatcattatcgatctctcagatgctaataat
gtcatgcgaagaccgatcagcgccgaaagcgcaatcatgcatccagtccaaaaggttatt
gccctcagagctcagaggcaactacaggtcttcaacatcgagctcaaacaaaaagtcaag
tcacacgcaatgaatgaggatgtttcgttttggaagtggatcaatgactcaactctgggc
atcgtcaccgagactgcagtttaccactgggctgcactcgacccaacaagtcctccggtc
aaagtcttcgatcgaaacgcgaatctagcaggccatcaaatcatcaactaccgcgcctcc
ccagatgagaaatggatggtcctcgtcggcatcaccgggaaccctagcaaccccagcgct
ttcaaggtcaaaggtagcatgcaactctacaacaaggatcgtgccgtcagccaatcgatc
gaaggccatgctgccagctttgctgattatcgcttagagggggctgccagcgatagcaaa
ctatttgcctttgctgttcggaccgcagccggtgccaaacttcacattgttgaaatagat
catcaagctggtcagccggttttcgctaagaaagcggtcgatgtcttcttcccgcctgag
gccaccaacgatttccctgtggcgatgcaggtctcaaagaagcacaagatcatctacatg
gtcaccaagtacggatttattcatctctatgatgtcgagacggccgcatgtatctacatg
aaccgaatctctggcgagactatctttgtaactgccgaacatgagacgagttcgggtatc
atcggagtcaatcgaaaaggacaagtactctcggtaaccgtcgatgaagaaactatcgta
cctttcattctcaacacgctcaagaaccccgagctagccatcaagctggcctccagggct
gaccttcccggagccgatgatatctacattcaacagttccaacaacttttctcgtctggt
cagttttccgaggcagctaaagttgccgccaattctccacgcggaatcctgagaactcca
cagacgatcgagcaattcaaaggcgttcccatgcaaccaggtcaactcagtccgatctta
cagtacttcgggatcctcttggaaaggggaaaactgaaccagaccgagagtttggagctt
gctcgtccggtgcttgttcaaggtcgcaaacaactcctagaaaaatggctcaaagaagac
aagttggactgcagtgaggaattaggtgacatcgttcgagcacacgatatgactctggct
cttagtgtctaccttcgtgccaacattcctaataaggtctgcgcatgttttgccgagaca
gggcaatccaataaaatcgtggtatacgccaagagggtcggctttactcccgattacgcc
tcgctcctacaacatatcacacgcttgaaccctgatagtggagcggaatttgcaacctcc
ttgatcaacgacgaatctggtcctctggtggatgtcgagcgagttgtcgatatcttcatg
gcccagaacatgatccaacaagccaccagtttcctcttggatgccttaaaagaaaaccga
cccgagcagggctatctgcagaccaaacttctggagatgaaccttctaaatgcacctcaa
gttgccgatgccatcttgggtaatgagatgttttcacattatgatcgtccaagcattgcc
aatctctgtgaaaaggctggattgttacagcgcgcgctggagcactacgaagacatctct
gatattaagcgcgtgctggttcacaccaaccttctcaatcctgattggcttgtgaactac
tttggaaaattgactgtcgatcaaacagtcgattgtttctgtgaaatgctcaaggtcaac
atccgccagaacctacagatcgtagtccaaggcgccaccaaatactctgatctcgtagga
ccggtgagacttatcgaaatgtttgaatctttcaagacgttcgagggactttactactac
cttggctcgatcgtcaaccttagtacagaccccgaggtgcatttcaagtacatccaggca
gccaccaggacaggtcaaatcagagaagtcgaacgaatctgtcgagaatcgaattactat
cctcctgaaaaggtcaaaaacttcttgaaagaagccaagttaacggatcaattacctttg
atcatcgtctgcgaccgatttgactttgtccacgacctagttctcttcctttaccaaaat
ggcttgaccagctttatcgaggtttacgttcagaaagtcaactctcaaagggcaccccag
gtcattggagggctgctggacgttgatgcggacgaaatgatgataaaaaacttgttggca
tccgtcaccggcccgattcctgtagacgaactagtcgaagaagtcgaaaaacgaaatcga
ttgaaattgatcttaccctggctcgaagcacgaattgcaatgggaatcactgatgtcggc
ctgtacaacgccatggctaagattttgattgatagtaaccaaaaccctgaagcattcttg
aaagaaaacaccatctatgatcccctcaccatcggtaaatattgcgagaagcgagaccct
actttggcctacatcgcatatgcccgaggattttgcgatgaggatctggttcggatcacg
aatgaaaactcgatgttcaagcagcaagcccgttaccttgtcaagcgtcgacagctcgag
ttgtgggcccaagtcttgcagcccgataacatgcatcgtcgacaattggtcgatcaagtg
gtatctactgctgtgccagaaagccaaaatcctgaggatgtctcggtcaccgtcaaggca
ttcctagctgccgatttaccgatcgaactgatcgagctgctggagaagatcgttctagag
ccatcggcattcagcgacaatgcgaatctgaagaagctgctactcttaaccgccatccga
tctgagaagggtaaagtcatgggctacatcgataagttagaaggtattgatgttagcgag
atcgctggaattgcgatcgagcatgagttgtttgaggaagcttttacccttttccgcaaa
cacaagatgcacttggaggctatgaatgtgctggtcgagcatgttgtgagtatcgatcga
gcagcccaatacgccacaaaagtcaatgagcctgccgtatggagtcggttgggtaaggcg
caactagacggtttgaggatcaaggatgcgatcgactcctacatcaaggctgaggatccg
accaactatttggagctcattgaaaccgccgaccgagcaggtaaacatgatgatatggtc
cgatacttgcaaatggccagaaagacgctccgggaacccaaaatcgataccgaactttgt
gttgcttatgccaagaccgacagactgcacgacatggaagagttcctttcgatgtccaat
gtggctgatcaactgagtgcaggagagcaggtatttgaggccggcctgtacgaggccgct
cggttgctcttctcggcgatctcgaactgggcccggctggctaccactttgatttacctt
ggcgacaatcaagctgccgtcgattgtgcccgtaaggctgggaacacgcaagtctggaaa
caagtcaattcggcttgtgtcgataagaaggagttcagacttgctcaggtctgtggattg
aacttggtcgtacacgctgaagaactacaatccttggtcaaactctacgagactagaggc
tattttgaggagttgatgcaactcctagaagctggtttgggactcgaacgtgctcacatg
ggaatgttcacagaactctcaatcttgtatgcgaagcataagccatccaagttaatggaa
catttgaagctattttggtcgaggatcaacatccccaaagtgatccgggccaccgagcaa
gcccatctctggcccgaactggtgttcttatacattcattatgatgagtttgataacgcg
gtcttggctatgatggaacgatcagcggatgcttgggatcatggtcaattcaaagacatc
attgtcaaagtggccaatgttgagttgtattataaagcgctatcgttttatttgcaagaa
caacctacgctcttgacggatctgttgacggttctagttccacgaatcgatcacaccaga
gtagtgaagatgttccaaaagacggacaatctgccgttgatcaagccgtacctgattgcc
gtccaacatctggacctacctgcgatcaacgaagcctaccacgacttattgatcgaagaa
gaagattatgcgacgcttcgagactcgttgtcgaaccatgaaaacttcgaccaagtcagt
cttgccaaacggctcgagaatcacgagctgctcgagttcagacgtttggctgcattgctc
tatgccaagaatgccaagttcgaagagtcgatcagcttgagcaagaaagatcaactcttc
aaggacgctatgatcaccgccgctagctccgcttctaatgagatcgtggaggaattgctc
gagtatttcgtcaaggtcggcaacaaggaatgctttgccgcgtgtctttacatctgttac
gacctcattcgtcccgacgtggttgaagacttacagtggagatatgcacttaacgattac
actatgccttatcgattacaacagatgagggaacagactaatcggatcgagcagatcgaa
cgccaattaaaagagctaagtctgagatcagcgaaagcggtagaagagactgaatcgaag
ccgatcattgggccaggctttggaggcagattgatgctcacccaaggcccgtccaacggg
atgatgggcggccaacccaccggcgctccgtccggatacggcggcaccggcggaatgatg
ggcggaatgcaggcccaacccacgggcatgatgggacagcaattcacagggatgcctggg
atgatgggcttttaa

DBGET integrated database retrieval system