KEGG   Puccinia graminis: PGTG_04715Help
Entry
PGTG_04715        CDS       T02226                                 

Definition
CMGC/MAPK/P38 protein kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
pgr  Puccinia graminis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PGTG_04715
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PGTG_04715
Protein kinases [BR:pgr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PGTG_04715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 396 aa AA seqDB search
MVEEAGSGALPSGSAPPIGNSISPGGPGFVMADFAKLSIFGTVFEVTTRYTDLQPVGMGA
FGLVCSANDQLTATNVAIKKIMKPFSTPVLAKRTYRELKLLKHIRHENIISLSDIFISPL
EDIYFVTELLGTDLHRLLTSRPLEKQFIQYFLYQILRGLKYVHSAGVVHRDLKPSNILVN
ENCDLKICDFGLARLQDPQMTGYVSTRYYRAPEIMLTWQKYDVAVDIWSAGCIFAEMLEG
KPLFPGKDHVNQFSIITELLGTPPDDVIATICSENTLRFVQSLPKRDRIPFSTKFKNADP
LALDLLERMLVFDPLKRINATEALANEYLSPYHDPTDEPIANEPFDWSFNDADLPVDTWR
VMMYSEILDFHDVKEPPTGHEQAQSAHEQAQAIESN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagaagctggttctggcgctctcccctcaggttctgccccgccgatcggaaat
agcatctcacctggtggtcctggcttcgtgatggctgacttcgcaaagctttcgatcttt
ggcacggttttcgaggtcaccacaagatataccgacctccaacccgtaggaatgggcgca
ttcggattggtgtgttcggccaatgaccagttgacggctacgaatgtggcaatcaagaag
atcatgaaaccattctcaacgcccgtattggcaaaaagaacctacagagaattgaaattg
ttaaagcacatcagacacgaaaacatcatcagtctctcagatatctttatctctcccttg
gaggatatctactttgtgaccgagttattgggtaccgatctgcataggttattgacctct
agacccttagaaaaacagttcatccaatactttctttaccagatcttgcgtggcttgaaa
tacgtccactcagctggtgttgtccatcgtgatttgaaaccatccaatatattggtcaac
gaaaactgcgatctgaagatatgcgattttggattagcaagattacaagatcctcagatg
accggatacgtctcaacacgatattatcgtgcgcccgagattatgctaacttggcagaaa
tacgatgtggctgtcgacatatggagtgctggttgcatctttgctgaaatgttagaaggc
aagcctttattccccgggaaagaccacgtcaatcaattctccatcattaccgagttactt
ggaactcctcctgacgatgtgattgccacaatctgttcggaaaatacgcttcgatttgtc
caatccttgccaaagcgagaccggattcccttcagcaccaagttcaagaacgccgatcca
cttgcgttagacttactcgagaggatgttggtgtttgatcccctaaagcggatcaatgcc
accgaggctttagccaatgaatatttatctccttatcatgatccaactgatgaacctatt
gccaatgagcctttcgactggtcctttaatgatgctgatttgcccgtcgacacttggagg
gtcatgatgtattccgaaatcttagacttccatgatgtcaaagaacctcctacaggacat
gagcaagctcagtcagcccatgaacaagcacaagccatcgaatccaattga

DBGET integrated database retrieval system