KEGG   Puccinia graminis: PGTG_04816Help
Entry
PGTG_04816        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pgr  Puccinia graminis
Pathway
pgr00052  Galactose metabolism
pgr00500  Starch and sucrose metabolism
pgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PGTG_04816
   00500 Starch and sucrose metabolism
    PGTG_04816
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PGTG_04816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_68
Motif
Other DBs
NCBI-GeneID: 10536964
NCBI-ProteinID: XP_003323279
UniProt: E3K303
AA seq 777 aa AA seqDB search
MTRKHDLPTNNRRTTTWVALHLLYGALLLGSFAGASSLLQLAKREEHPQDTFAADKAGPN
LSSHNNFPSFLNSTSDSCRIDRSQPPVLDQLIGCKNSSLFHLWRTKARVTGPRGWMNDPM
AIFETKSGAYHVGYQCNPDHLVWANISQCSAFTTDFVHFKDHHSWKDPRTIVPTQLYDIR
GVFDGTVIKDGWNGHPSIIYTSVFTGPIGARSNPPELEGVETQSVAYTEDDGHTWTKLNF
GANGNPVIYKWPENHLSGFRDPFVFKSSEFSRFYANESIVHQLPGNPNALKPSGHNYLLL
SGGIRTEVDPIHGGPRLFLYRQTEENNIRDWTYLGPLVSSIAERNQTSEWTGAKGINYEC
GAVTKLDEHGLVKQEDDSADSKTQLNIIATGSEGGRTGPGYWPIWHAVSWDFDADDGNVR
SKIDFSGVIDWGKAYAFHLFESKNRQLLVGWTYEDDEKNILTPQRGAQGAFTLFRELFVQ
VLRNIHPAALKSPEHAPSWTTRTEADGSHSLMTVGQRILPEISSAFRKHSKVSALPPQTL
SPGYNPGAHQHSLSTNAVRLEKQPKDRYYAISARLEFYADRRELDGEDVGRAKMSRGGFR
ILSSQNEWTDVYYDPSTEYLVVDRSRSSAIPSFGNSSERAKLRLWPIVNPVTKRVEIEPL
NLTIIVDNSVVEVHANERAIITTRVYPWYEDSIGIDYLVEGRPTVVDELHLARHSALSEN
QNRLGSHAFQPHSVHFTNVEIWDGLVNAWPDRPRDTRLPGVYSHNITSSLYGLWPDL
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaaacacgacttgcccacgaataaccggagaactactacttgggttgcgttg
catctcctttatggggcactccttctgggcagcttcgccggcgcttcttcgcttcttcag
ctggccaagcgcgaagaacatccccaagacacctttgctgctgataaagccggtccaaac
ctatcctctcacaacaacttcccaagctttctgaactcgacctctgattcttgtcggatt
gaccgctcacaaccgccggtactggaccaactgattggatgcaagaattcttccttgttt
catctgtggcgtaccaaagcacgagtaaccgggccgcgaggatggatgaatgatcctatg
gcaattttcgaaaccaagagcggagcttatcacgtgggctaccaatgcaatccggatcat
ctcgtgtgggcgaatatctcacaatgttcagctttcaccacggactttgtccatttcaag
gatcaccatagctggaaagatccacgaaccattgtaccgactcagctgtatgacattaga
ggcgtatttgatggcacagtgatcaaggacggctggaatggtcatccgagcatcatatac
acctccgtattcaccggccccatcggagcccgaagtaatccacctgaacttgaaggcgtg
gagacgcagagtgttgcctacaccgaggatgatggacacacttggaccaagttgaacttt
ggggccaacggcaatccagtaatttacaagtggccagaaaatcatctctctggattcagg
gacccatttgtattcaaatccagcgagttttccagattttacgccaacgagtcaattgtc
caccagctgcctggcaatccgaatgcgctcaaacccagtggccacaattatctactcctg
agtggtggaatccgaacggaagtcgatccaatccatggcggaccgcgcctgttcctctac
cgacaaaccgaggagaacaatattcgggattggacctatctaggccccttggtatcttcg
atagctgaacgcaaccaaaccagcgaatggaccggcgccaaaggtatcaactatgaatgc
ggcgcggtcaccaaattagacgagcacggattggtcaagcaggaggacgactccgcagac
tctaagactcagctcaacatcattgccacaggatctgaaggcggtcggaccggcccgggt
tattggccgatttggcatgccgtcagttgggattttgatgcggatgacggaaacgtgaga
tccaagatcgatttttccggggtgattgattggggaaaggcgtatgcgttccatctgttt
gagtcgaaaaatcgccagctccttgtcggttggacatacgaagacgacgagaagaatatc
ctgacaccccagagaggagcccaaggtgcatttaccctgttcagggaattatttgtccaa
gtcctccggaacatccatccggccgcactgaagtctccggagcatgcacctagctggacc
acccgaactgaagccgacgggagccattctctgatgactgtaggccaaaggattctccca
gaaatcagctcggccttccgcaaacattccaaagtttcagcactcccacctcagaccttg
agccctggatacaacccgggggcccaccagcacagtctttcgaccaatgcagtccggctc
gaaaagcaacccaaagatcgttactatgccatcagtgcccgcctcgaattttacgctgat
cggagagagctcgatggcgaagatgtcggccgtgccaaaatgtctcgtgggggcttccgt
atactgtccagccagaacgaatggactgatgtgtactacgatccaagcaccgagtacctc
gtagttgacaggtctcgcagttctgccattccatctttcggtaattcctcggagcgcgcc
aagctccgattgtggccgatcgtcaaccccgtcaccaaacgagtggaaatcgagcccctg
aacttgacgattatcgtcgacaacagcgtcgtcgaggtccacgccaacgagcgagcaatc
atcaccacacgggtctacccttggtacgaagattcgatcgggatcgactatttggtcgaa
ggccgcccaactgtggtcgatgagctccacctcgccaggcattcggctctatctgaaaac
caaaaccggctcggctctcatgccttccagcctcattccgtccatttcaccaacgtcgag
atatgggatgggctggtcaacgcttggccagaccggccccgcgatacccgtcttcccggg
gtctacagtcacaatatcaccagctctctttatggcctatggcctgacctgtga

DBGET integrated database retrieval system