KEGG   Puccinia graminis: PGTG_04959Help
Entry
PGTG_04959        CDS       T02226                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pgr  Puccinia graminis
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pgr00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 307 aa AA seqDB search
MAPLTLASARYGKEKVRVFRVVKSGTWHEVVEYTISVLLEGQIASSYTKADNSVVVATDS
MKNTINVFAKTSPHVLTPELFSLHLGTHFVSEYEHIGKAIVTVISHRWSRIPLDQKPHPH
AFTRDGNDVTRIEAIITKSNSGSTSAELSTGLQDLLVLKTTGSAFENFIRDKWTTLPEAS
DRILSTSVDCRCAIKINLPSDGSLAISSLANLGIDFKAIGKSVREITLETFATDESASVQ
ATLYKMCQLILTAHTEILSVSYSLPNKHYIPIDLSWHDNIQNTSVQDAEVFVPLEAPSGL
ITATVSR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctccgttgacgctcgcgagcgcaagatatggcaaggaaaaggtccgagttttccga
gtcgtcaaaagtggtacttggcatgaggtcgtagaatataccatcagcgtgctgctggaa
ggtcagatcgcttcgtcttacaccaaggcggataattcggttgtagttgctaccgacagc
atgaagaatactataaacgtgtttgccaagacctcacctcacgtacttacacccgagctg
ttctcgttgcaccttggcacacattttgtttctgaatacgagcacattggaaaagctatc
gtgaccgtcatctcacatcgatggtcccgcatcccactcgatcagaagccgcatcctcat
gcattcacccgtgacggcaatgacgttacacgaatcgaggcgattatcactaaaagcaat
agtggctcaacttctgctgagttgagcactggtctgcaggatctcctggtcttgaaaacc
accggaagcgcgttcgagaactttatcagagataagtggaccacgcttcccgaagcttca
gatcgaattctgtcgacctctgttgattgtcgatgcgctatcaagataaatcttccatca
gacggctcacttgccatttcttcccttgcgaatctgggaatcgacttcaaggcgatcggc
aaatcagtcagggaaatcacgcttgaaacgtttgccaccgatgaaagcgctagtgttcaa
gctacactttacaaaatgtgccagctcattctgactgctcacactgagattctcagcgta
tcttacagccttcccaataagcattacattccaatcgatctcagttggcatgataatatc
caaaacacatccgttcaagatgcagaggtttttgtgcctctggaagcaccgtcaggtttg
atcactgccactgtttcaagataa

DBGET integrated database retrieval system