KEGG   Puccinia graminis: PGTG_05095Help
Entry
PGTG_05095        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pgr  Puccinia graminis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgr00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 348 aa AA seqDB search
MSFVKTDSSITIKTSTAQAEIAFHGAHVYSWKVEGKEQLFLSSASSISGPAAIRGGIPIC
FPVFGPPPSREPYASLKQHGFARNTSWKFDGVEEGSDWIEARFSLDSNNPEVQKVFKPAF
ECQYRVKIRERSLVTSLEVTNPSETTFELQALLHTYLRLPDQGSPQDVRLGPLKGLSFAD
KVAQGAVDTEDREAVDFLAGEVDRVYHGVPSKIEVELGHGKKMTIKTDGLPDLTVWNPHE
ARVTRWPTWKTRAGNGSCVSSLAKPVSSPSSRTVLGRALKNSSLIYERNRPLRTIKACLE
EGSPSLTSRSCLLDSSNFEHDVPFLHLYPLILTDFIYLSKNIAAAGFP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgtcaagactgactcgtcgatcaccatcaagacctcgactgctcaggcagag
atcgcattccatggggctcacgtctactcgtggaaggtcgaggggaaagagcagttgttc
ttgtcctctgcgtcctcgatctctggaccggctgccattagaggtggaatcccgatctgc
ttcccagtctttggcccaccaccttcaagagaaccgtatgcaagtctcaagcaacacggc
tttgcacgaaacaccagctggaaattcgatggagttgaagaaggaagcgattggatagag
gcccgcttcagcttagattcgaataaccccgaggtccagaaagtgttcaagccagccttc
gaatgtcagtacagagtcaagattagagagcgaagtctggtgaccagtctggaggtgacg
aacccctcggagacgacgttcgagctgcaagcgctcctgcacacctatctccgtctgccc
gaccaaggatcgccccaggatgtccgtctgggcccactgaagggcttgtcgtttgctgac
aaagtggcccagggcgcggtggataccgaggatcgagaggccgtcgacttcctggcgggc
gaggtcgatcgggtctatcatggcgtaccatctaagatcgaggtggagctaggacacggc
aagaaaatgacgatcaagaccgatggactaccggacctgaccgtctggaaccctcacgag
gcaagagtaacgcgatggccgacatggaaaacgagggctggaaacggttcgtgtgtatcg
agcctggccaaaccagtttcgtctccgtcaagccgaacggttcttggaagggctctcaag
aactcgtcgctcatctatgaacgaaaccgcccgcttcggactatcaaagcttgcctcgaa
gaaggaagtccttcactcacttccagatcctgtctacttgattcctccaacttcgaacat
gatgtccccttcctccacttgtatcccctgatcttgaccgactttatatatctcagtaaa
aacatcgctgccgccggctttccataa

DBGET integrated database retrieval system