KEGG   Puccinia graminis: PGTG_05281Help
Entry
PGTG_05281        CDS       T02226                                 

Definition
histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PGTG_05281
Transcription machinery [BR:pgr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PGTG_05281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 416 aa AA seqDB search
MREAEEEEEQPSKRIKLTQPLDIKQSLSTLEPEPEPEKEEGVLVEAEAEVEEEPTDDILS
SHQSTRSLKPAIYEELQNIIRFVVVTNDGEPDSSILLTGLKNLFQRQLPNMPREHIARLV
YSRDHASLAIVKRGLDVVGGITYRAFESRGFAEIVFCAIRASEQVKGYGSHLMNHLKDHV
KQSTTCMHFLTYADNYAIGYFKKQGFSKDVSLDKSVWMGYIKDYEGATVMHCAMLPRIKY
LEASLILEKQKQAIMSKIKLISQSHVVHKGLEVFKQQPLLQPVNPVDVPGLKEIGWNPEL
DQLTRKPQRLACHNIIHHLLTSLQSHPSAWPFTKPINKDEVTDYYSVIKQPMDLETIELK
LENNRYLSLQQFLDDCKLIFSNCRTYNPDGSNYVKNANRLEKFLKDRVKQYDEIEY
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagaagaagaagaagaacaaccaagcaaacgaatcaaactcactcaacca
ctcgacatcaaacaatcactctcgaccctcgaaccagaaccagaaccagaaaaagaagaa
ggagtcctagtagaagcagaagcagaggtggaagaagaaccgacggatgatatcctatcg
agtcatcaatccactcgatcactcaaaccggcgatctacgaagagctgcaaaacatcatc
cgatttgtcgtggtgaccaacgatggagagccggactcctcgatcctcttgacgggtctc
aagaacctcttccaacgccaactgcccaacatgccgcgggaacacatcgcccgactggtc
tattcgcgagaccatgccagtctggcgatcgtcaaacgcggcctggatgtcgtcggcgga
atcacctacagggccttcgagtcccgcggattcgccgagatcgtcttctgcgctatcagg
gcctccgaacaggtcaagggttacggctctcatctcatgaatcatctcaaagatcacgtc
aaacagtccactacctgcatgcatttcctcacctatgcagataattacgctatcggttac
ttcaagaaacagggcttctccaaggacgtcagtcttgataaatcggtttggatgggctat
atcaaggattatgagggcgctactgtcatgcattgtgcaatgttaccaagaataaagtat
ctagaagcatcactaatcctagagaaacaaaaacaagcgataatgagtaagatcaagttg
atttcgcaatcacatgtggtccacaaaggcctcgaagtcttcaaacaacagccgctcctt
cagcctgttaatccagtcgacgtacccggtctcaaggagatcggttggaatcctgaacta
gatcaattgacgcggaagccccaacgactagcctgtcacaacatcatccaccacttgttg
acgagcttacagagccatccgtcggcctggccgttcaccaaaccgatcaataaggacgag
gtcaccgactattattcggtcatcaaacagcccatggacctcgaaacgatcgaactcaaa
ctcgaaaataatcgctacctttcactccaacagttcctggatgactgtaaactcatcttc
agtaattgtagaacttataatcctgacggctcgaattatgttaaaaacgctaatcggttg
gagaaatttctgaaggaccgagtcaagcaatacgatgagatagagtattaa

DBGET integrated database retrieval system