KEGG   Puccinia graminis: PGTG_05736Help
Entry
PGTG_05736        CDS       T02226                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pgr  Puccinia graminis
Pathway
pgr00010  Glycolysis / Gluconeogenesis
pgr00030  Pentose phosphate pathway
pgr00051  Fructose and mannose metabolism
pgr00052  Galactose metabolism
pgr00680  Methane metabolism
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
pgr01130  Biosynthesis of antibiotics
pgr01200  Carbon metabolism
pgr01230  Biosynthesis of amino acids
pgr03018  RNA degradation
Module
pgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTG_05736
   00030 Pentose phosphate pathway
    PGTG_05736
   00051 Fructose and mannose metabolism
    PGTG_05736
   00052 Galactose metabolism
    PGTG_05736
  Energy metabolism
   00680 Methane metabolism
    PGTG_05736
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PGTG_05736
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PGTG_05736
Protein phosphatases and associated proteins [BR:pgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PGTG_05736
Messenger RNA biogenesis [BR:pgr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PGTG_05736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 10531239
NCBI-ProteinID: XP_003323834
UniProt: E3K4D7
AA seq 840 aa AA seqDB search
MIKIAVLTSGGDSAGMNAAVRSVVRTGISKSCEVYVVREGYEGLVRGNEAHPEKHKADTL
MIPEIHSNTRPQWLKTSDRPLSTNFISTYFGAESLKHGEADSELRGQHIIRVGWDDVGPF
LSEGGTLIGTQRSQSFRQLEGRRKAAHNLIIHGINALVVCGGDGSLTGADKLRAEWPEHV
NALLASNEITAEQAQTYHHLIIVGLVGSIDNDMAMTDVTIGAPTALHRICESIDNISSTA
SSHSRAFVVEVMGRNCGWLALMAGMSSGADYVFIPEKPPAYDDWEHELCEALRRHREMGK
RKSIVIVAEGAIDKNLQPIKADYIASILTDRLKLDTRVTTLGHTQRGGKPCAYDRILATL
QGIEAVEAVLELSRNPEGESPLIGLRENQIIRVPLMKAVETTQALAKAIANKDFKHAMSL
RDTVYQTSFDAFAATTRLDTRIKLPDSQQMRIGIIHIGAPAGGMNAATRTAVRYCLTRGH
TPLAIFNSWTGLMDGHVEELGWLRVDQWTTRGGSELGTNRVLPSADNIDEIVARIKMFKL
DGLLLIGGFEVLKSLQFLDSVKSQYTELDIPMVHLPATISNNVPLTEWSLGSDTSINVLV
EACDAIRQSASASRSRVFVVETQGGECGYIAMLGALATGAAVVHTPEIPIGLEQITKDVQ
FLKRRFLADRKGKSLGRLLIRSDKASKTYTNEVMTRILNEEGRGLFDARQVSLGHTLQGA
IPSPRDRTRAVALSIQCIAFLERHSTKVDPSEHRTPPASASVLNRNTSLPKVEPINQDDE
NMWGTIVITGSLIRIANLQEMIENADFVNRRALKPWWADFKNLVEIMAGKKQDEICNIQA
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaatcgctgtactcacctcgggtggcgatagtgccgggatgaatgcagcagtc
agaagcgtagtaagaactggaatctcaaaatcgtgcgaagtgtatgtggttcgagaggga
tacgaaggactagtccgagggaacgaagcccaccccgaaaagcacaaggcggacaccctg
atgatcccagaaatccacagcaacactcgtccgcaatggctcaagacctccgatcgaccg
ctgtccactaacttcatctccacctacttcggcgccgaatccctcaaacatggcgaggct
gacagcgaactcagagggcaacatatcatcagggtcgggtgggatgatgtcggtccgttc
ctaagtgagggtggtaccttaatcggaacccaacgatctcaaagctttcggcaacttgaa
ggccgcagaaaagccgcgcacaacttaatcattcacgggatcaatgcgctcgtagtatgt
ggaggagatggctccttgaccggtgcggataagcttcgagcggaatggcccgaacatgtg
aatgcgttacttgcctcaaatgagatcacagccgaacaagcccaaacataccaccacttg
atcatcgtaggattggtgggctcgatcgacaacgacatggcgatgacggatgtgacgatc
ggcgcgcccacggcgctccatcggatctgcgagtccatcgacaacatctcctccaccgcc
tcctcgcattccagagccttcgtcgtcgaagtcatggggcgcaattgtggatggttggcc
ttgatggctggaatgagctccggtgcagattatgttttcatccctgaaaaaccaccggca
tatgatgattgggaacatgagctatgtgaagccttacggagacatcgagagatggggaaa
cggaagagcatcgtgatagtagcagaaggagcgatcgacaagaacctacagccgatcaag
gcggactacattgcctcgatcctgacggaccggttgaagctagacacccgagtgaccacc
ttgggtcacacccaacgaggggggaagccgtgcgcatatgaccgcatcctcgcgaccctt
caggggatcgaggccgtcgaggccgtcctcgaattgtcccgcaatccggagggcgaaagc
ccgttgatcggcttgcgcgaaaaccaaatcattcgggtcccactcatgaaagccgtcgaa
accactcaagccttggctaaagcgatcgccaataaggatttcaaacatgcgatgagtctc
agagatacggtatatcaaaccagtttcgatgcatttgcggcgaccactcggcttgatacg
cggatcaaactgccagattctcagcagatgcggatcgggataatccatattggtgcacca
gcaggcgggatgaatgcggcgacccggacggcggtgcgatattgcttaacccggggacac
acgccgctggcgattttcaacagctggacggggctgatggacgggcatgtggaggagctg
gggtggctgcgggtggaccaatggacgacccgtggcgggtccgagctgggcaccaatcgg
gtcctgccctctgctgacaacatcgacgaaatcgtcgcccggattaagatgtttaagctc
gatggtctcctcctcatcggtggattcgaggtgctgaagagcctccaattcttggactcc
gtcaagagtcaatacactgaattggatatccccatggtccatttacccgctacgatcagt
aataatgttccgttgactgaatggagtttggggagtgatacaagtatcaacgtcttagtg
gaagcgtgtgatgcgatccgacaaagtgcctcagccagtcgtagtcgagtgtttgttgtt
gagactcaaggcggagaatgtggttatattgccatgctaggggccttagcaacaggggca
gcggtagttcatacgccggagatcccgatcggcttggagcagatcacgaaagatgtgcag
ttcttgaagcgacgattccttgcggaccggaaggggaagtcactgggccgactattgatc
cggtcggacaaggcgtcgaagacgtacacgaacgaggtgatgacgcggatcctgaatgag
gaggggcggggtttgtttgatgcgcgccaggtgagtctggggcacaccttacagggagcg
atcccttctcctcgggaccggacccgggcagtggccctgtcgatccaatgcatcgccttc
ctcgagcgccattcgaccaaggtcgatcctagcgaacatcgtaccccgcctgcttcggca
tcagtcctcaatcgcaatacttctctgcctaaggtcgagccgatcaatcaggacgacgag
aatatgtggggcactatcgtgatcacgggcagtcttatcaggatcgctaacctccaggag
atgatcgagaatgccgactttgtcaatcgtagagcgctcaagccttggtgggctgatttc
aaaaacctcgtcgaaatcatggcgggtaaaaaacaggatgagatctgtaatatccaggct
tga

DBGET integrated database retrieval system