KEGG   Puccinia graminis: PGTG_05736Help
Entry
PGTG_05736        CDS       T02226                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pgr  Puccinia graminis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGTG_05736
   01230 Biosynthesis of amino acids
    PGTG_05736
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTG_05736
   00030 Pentose phosphate pathway
    PGTG_05736
   00051 Fructose and mannose metabolism
    PGTG_05736
   00052 Galactose metabolism
    PGTG_05736
  Energy metabolism
   00680 Methane metabolism
    PGTG_05736
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PGTG_05736
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PGTG_05736
Protein phosphatases and associated proteins [BR:pgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PGTG_05736
Messenger RNA biogenesis [BR:pgr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PGTG_05736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 840 aa AA seqDB search
MIKIAVLTSGGDSAGMNAAVRSVVRTGISKSCEVYVVREGYEGLVRGNEAHPEKHKADTL
MIPEIHSNTRPQWLKTSDRPLSTNFISTYFGAESLKHGEADSELRGQHIIRVGWDDVGPF
LSEGGTLIGTQRSQSFRQLEGRRKAAHNLIIHGINALVVCGGDGSLTGADKLRAEWPEHV
NALLASNEITAEQAQTYHHLIIVGLVGSIDNDMAMTDVTIGAPTALHRICESIDNISSTA
SSHSRAFVVEVMGRNCGWLALMAGMSSGADYVFIPEKPPAYDDWEHELCEALRRHREMGK
RKSIVIVAEGAIDKNLQPIKADYIASILTDRLKLDTRVTTLGHTQRGGKPCAYDRILATL
QGIEAVEAVLELSRNPEGESPLIGLRENQIIRVPLMKAVETTQALAKAIANKDFKHAMSL
RDTVYQTSFDAFAATTRLDTRIKLPDSQQMRIGIIHIGAPAGGMNAATRTAVRYCLTRGH
TPLAIFNSWTGLMDGHVEELGWLRVDQWTTRGGSELGTNRVLPSADNIDEIVARIKMFKL
DGLLLIGGFEVLKSLQFLDSVKSQYTELDIPMVHLPATISNNVPLTEWSLGSDTSINVLV
EACDAIRQSASASRSRVFVVETQGGECGYIAMLGALATGAAVVHTPEIPIGLEQITKDVQ
FLKRRFLADRKGKSLGRLLIRSDKASKTYTNEVMTRILNEEGRGLFDARQVSLGHTLQGA
IPSPRDRTRAVALSIQCIAFLERHSTKVDPSEHRTPPASASVLNRNTSLPKVEPINQDDE
NMWGTIVITGSLIRIANLQEMIENADFVNRRALKPWWADFKNLVEIMAGKKQDEICNIQA
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaatcgctgtactcacctcgggtggcgatagtgccgggatgaatgcagcagtc
agaagcgtagtaagaactggaatctcaaaatcgtgcgaagtgtatgtggttcgagaggga
tacgaaggactagtccgagggaacgaagcccaccccgaaaagcacaaggcggacaccctg
atgatcccagaaatccacagcaacactcgtccgcaatggctcaagacctccgatcgaccg
ctgtccactaacttcatctccacctacttcggcgccgaatccctcaaacatggcgaggct
gacagcgaactcagagggcaacatatcatcagggtcgggtgggatgatgtcggtccgttc
ctaagtgagggtggtaccttaatcggaacccaacgatctcaaagctttcggcaacttgaa
ggccgcagaaaagccgcgcacaacttaatcattcacgggatcaatgcgctcgtagtatgt
ggaggagatggctccttgaccggtgcggataagcttcgagcggaatggcccgaacatgtg
aatgcgttacttgcctcaaatgagatcacagccgaacaagcccaaacataccaccacttg
atcatcgtaggattggtgggctcgatcgacaacgacatggcgatgacggatgtgacgatc
ggcgcgcccacggcgctccatcggatctgcgagtccatcgacaacatctcctccaccgcc
tcctcgcattccagagccttcgtcgtcgaagtcatggggcgcaattgtggatggttggcc
ttgatggctggaatgagctccggtgcagattatgttttcatccctgaaaaaccaccggca
tatgatgattgggaacatgagctatgtgaagccttacggagacatcgagagatggggaaa
cggaagagcatcgtgatagtagcagaaggagcgatcgacaagaacctacagccgatcaag
gcggactacattgcctcgatcctgacggaccggttgaagctagacacccgagtgaccacc
ttgggtcacacccaacgaggggggaagccgtgcgcatatgaccgcatcctcgcgaccctt
caggggatcgaggccgtcgaggccgtcctcgaattgtcccgcaatccggagggcgaaagc
ccgttgatcggcttgcgcgaaaaccaaatcattcgggtcccactcatgaaagccgtcgaa
accactcaagccttggctaaagcgatcgccaataaggatttcaaacatgcgatgagtctc
agagatacggtatatcaaaccagtttcgatgcatttgcggcgaccactcggcttgatacg
cggatcaaactgccagattctcagcagatgcggatcgggataatccatattggtgcacca
gcaggcgggatgaatgcggcgacccggacggcggtgcgatattgcttaacccggggacac
acgccgctggcgattttcaacagctggacggggctgatggacgggcatgtggaggagctg
gggtggctgcgggtggaccaatggacgacccgtggcgggtccgagctgggcaccaatcgg
gtcctgccctctgctgacaacatcgacgaaatcgtcgcccggattaagatgtttaagctc
gatggtctcctcctcatcggtggattcgaggtgctgaagagcctccaattcttggactcc
gtcaagagtcaatacactgaattggatatccccatggtccatttacccgctacgatcagt
aataatgttccgttgactgaatggagtttggggagtgatacaagtatcaacgtcttagtg
gaagcgtgtgatgcgatccgacaaagtgcctcagccagtcgtagtcgagtgtttgttgtt
gagactcaaggcggagaatgtggttatattgccatgctaggggccttagcaacaggggca
gcggtagttcatacgccggagatcccgatcggcttggagcagatcacgaaagatgtgcag
ttcttgaagcgacgattccttgcggaccggaaggggaagtcactgggccgactattgatc
cggtcggacaaggcgtcgaagacgtacacgaacgaggtgatgacgcggatcctgaatgag
gaggggcggggtttgtttgatgcgcgccaggtgagtctggggcacaccttacagggagcg
atcccttctcctcgggaccggacccgggcagtggccctgtcgatccaatgcatcgccttc
ctcgagcgccattcgaccaaggtcgatcctagcgaacatcgtaccccgcctgcttcggca
tcagtcctcaatcgcaatacttctctgcctaaggtcgagccgatcaatcaggacgacgag
aatatgtggggcactatcgtgatcacgggcagtcttatcaggatcgctaacctccaggag
atgatcgagaatgccgactttgtcaatcgtagagcgctcaagccttggtgggctgatttc
aaaaacctcgtcgaaatcatggcgggtaaaaaacaggatgagatctgtaatatccaggct
tga

DBGET integrated database retrieval system