KEGG   Puccinia graminis: PGTG_05736Help
Entry
PGTG_05736        CDS       T02226                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pgr  Puccinia graminis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGTG_05736
   01230 Biosynthesis of amino acids
    PGTG_05736
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTG_05736
   00030 Pentose phosphate pathway
    PGTG_05736
   00051 Fructose and mannose metabolism
    PGTG_05736
   00052 Galactose metabolism
    PGTG_05736
  Energy metabolism
   00680 Methane metabolism
    PGTG_05736
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PGTG_05736
Protein phosphatases and associated proteins [BR:pgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PGTG_05736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 840 aa AA seqDB search
MIKIAVLTSGGDSAGMNAAVRSVVRTGISKSCEVYVVREGYEGLVRGNEAHPEKHKADTL
MIPEIHSNTRPQWLKTSDRPLSTNFISTYFGAESLKHGEADSELRGQHIIRVGWDDVGPF
LSEGGTLIGTQRSQSFRQLEGRRKAAHNLIIHGINALVVCGGDGSLTGADKLRAEWPEHV
NALLASNEITAEQAQTYHHLIIVGLVGSIDNDMAMTDVTIGAPTALHRICESIDNISSTA
SSHSRAFVVEVMGRNCGWLALMAGMSSGADYVFIPEKPPAYDDWEHELCEALRRHREMGK
RKSIVIVAEGAIDKNLQPIKADYIASILTDRLKLDTRVTTLGHTQRGGKPCAYDRILATL
QGIEAVEAVLELSRNPEGESPLIGLRENQIIRVPLMKAVETTQALAKAIANKDFKHAMSL
RDTVYQTSFDAFAATTRLDTRIKLPDSQQMRIGIIHIGAPAGGMNAATRTAVRYCLTRGH
TPLAIFNSWTGLMDGHVEELGWLRVDQWTTRGGSELGTNRVLPSADNIDEIVARIKMFKL
DGLLLIGGFEVLKSLQFLDSVKSQYTELDIPMVHLPATISNNVPLTEWSLGSDTSINVLV
EACDAIRQSASASRSRVFVVETQGGECGYIAMLGALATGAAVVHTPEIPIGLEQITKDVQ
FLKRRFLADRKGKSLGRLLIRSDKASKTYTNEVMTRILNEEGRGLFDARQVSLGHTLQGA
IPSPRDRTRAVALSIQCIAFLERHSTKVDPSEHRTPPASASVLNRNTSLPKVEPINQDDE
NMWGTIVITGSLIRIANLQEMIENADFVNRRALKPWWADFKNLVEIMAGKKQDEICNIQA
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaatcgctgtactcacctcgggtggcgatagtgccgggatgaatgcagcagtc
agaagcgtagtaagaactggaatctcaaaatcgtgcgaagtgtatgtggttcgagaggga
tacgaaggactagtccgagggaacgaagcccaccccgaaaagcacaaggcggacaccctg
atgatcccagaaatccacagcaacactcgtccgcaatggctcaagacctccgatcgaccg
ctgtccactaacttcatctccacctacttcggcgccgaatccctcaaacatggcgaggct
gacagcgaactcagagggcaacatatcatcagggtcgggtgggatgatgtcggtccgttc
ctaagtgagggtggtaccttaatcggaacccaacgatctcaaagctttcggcaacttgaa
ggccgcagaaaagccgcgcacaacttaatcattcacgggatcaatgcgctcgtagtatgt
ggaggagatggctccttgaccggtgcggataagcttcgagcggaatggcccgaacatgtg
aatgcgttacttgcctcaaatgagatcacagccgaacaagcccaaacataccaccacttg
atcatcgtaggattggtgggctcgatcgacaacgacatggcgatgacggatgtgacgatc
ggcgcgcccacggcgctccatcggatctgcgagtccatcgacaacatctcctccaccgcc
tcctcgcattccagagccttcgtcgtcgaagtcatggggcgcaattgtggatggttggcc
ttgatggctggaatgagctccggtgcagattatgttttcatccctgaaaaaccaccggca
tatgatgattgggaacatgagctatgtgaagccttacggagacatcgagagatggggaaa
cggaagagcatcgtgatagtagcagaaggagcgatcgacaagaacctacagccgatcaag
gcggactacattgcctcgatcctgacggaccggttgaagctagacacccgagtgaccacc
ttgggtcacacccaacgaggggggaagccgtgcgcatatgaccgcatcctcgcgaccctt
caggggatcgaggccgtcgaggccgtcctcgaattgtcccgcaatccggagggcgaaagc
ccgttgatcggcttgcgcgaaaaccaaatcattcgggtcccactcatgaaagccgtcgaa
accactcaagccttggctaaagcgatcgccaataaggatttcaaacatgcgatgagtctc
agagatacggtatatcaaaccagtttcgatgcatttgcggcgaccactcggcttgatacg
cggatcaaactgccagattctcagcagatgcggatcgggataatccatattggtgcacca
gcaggcgggatgaatgcggcgacccggacggcggtgcgatattgcttaacccggggacac
acgccgctggcgattttcaacagctggacggggctgatggacgggcatgtggaggagctg
gggtggctgcgggtggaccaatggacgacccgtggcgggtccgagctgggcaccaatcgg
gtcctgccctctgctgacaacatcgacgaaatcgtcgcccggattaagatgtttaagctc
gatggtctcctcctcatcggtggattcgaggtgctgaagagcctccaattcttggactcc
gtcaagagtcaatacactgaattggatatccccatggtccatttacccgctacgatcagt
aataatgttccgttgactgaatggagtttggggagtgatacaagtatcaacgtcttagtg
gaagcgtgtgatgcgatccgacaaagtgcctcagccagtcgtagtcgagtgtttgttgtt
gagactcaaggcggagaatgtggttatattgccatgctaggggccttagcaacaggggca
gcggtagttcatacgccggagatcccgatcggcttggagcagatcacgaaagatgtgcag
ttcttgaagcgacgattccttgcggaccggaaggggaagtcactgggccgactattgatc
cggtcggacaaggcgtcgaagacgtacacgaacgaggtgatgacgcggatcctgaatgag
gaggggcggggtttgtttgatgcgcgccaggtgagtctggggcacaccttacagggagcg
atcccttctcctcgggaccggacccgggcagtggccctgtcgatccaatgcatcgccttc
ctcgagcgccattcgaccaaggtcgatcctagcgaacatcgtaccccgcctgcttcggca
tcagtcctcaatcgcaatacttctctgcctaaggtcgagccgatcaatcaggacgacgag
aatatgtggggcactatcgtgatcacgggcagtcttatcaggatcgctaacctccaggag
atgatcgagaatgccgactttgtcaatcgtagagcgctcaagccttggtgggctgatttc
aaaaacctcgtcgaaatcatggcgggtaaaaaacaggatgagatctgtaatatccaggct
tga

DBGET integrated database retrieval system