KEGG   Puccinia graminis: PGTG_06424Help
Entry
PGTG_06424        CDS       T02226                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pgr  Puccinia graminis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PGTG_06424
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PGTG_06424
Enzymes [BR:pgr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PGTG_06424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 182 aa AA seqDB search
MKRLSSLLNHLQPPSPTTHASMAQFYNLKAILANGTEFDFAQTKGKVVLVVNVASKCGFT
TQYEGLEKLWQKFKDKDFQLIGFPCNQFGGQEPGTDSEIASFCKLNYGVTFPIAQKCDVN
GDNAHPVYNFLKSEKSGIMGLSRIKWNFEKFVVDKKGAVRYRHASTSKPESLEKEIEGLL
AE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagactatcatcactgctcaaccacctccaaccaccctcaccaaccacacacgca
agcatggcccagttctataacctcaaggcaatccttgccaacggtaccgagttcgacttc
gctcagaccaaagggaaagtcgtcttggtcgtcaacgtcgcttccaaatgtggctttact
actcagtacgaaggacttgaaaaattgtggcaaaaattcaaagacaaagattttcaattg
attggatttccttgtaatcaattcggaggacaagagccaggtacagactcagagatcgcc
agtttctgtaaactcaactatggtgttacctttccgatcgctcaaaagtgtgacgtcaat
ggcgacaatgcccatccagtttataacttcttgaagagtgaaaaatcaggaattatggga
ctctcacgaatcaaatggaacttcgagaaattcgttgtggacaagaaaggggccgttcgt
tatagacatgcctcgacttctaagcctgagtcacttgaaaaggagatcgaaggtttgtta
gccgaataa

DBGET integrated database retrieval system