KEGG   Puccinia graminis: PGTG_06617Help
Entry
PGTG_06617        CDS       T02226                                 

Definition
CMGC/MAPK protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PGTG_06617
Protein kinases [BR:pgr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PGTG_06617
Exosome [BR:pgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGTG_06617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 412 aa AA seqDB search
MASAAVALPSSATGGSLNPTAPASTSVNATTTTSITNAPANKPKQAGSRAVGEPRRVRFN
VGSKYHVMDVIGEGAYGVVCSAIHRPTGQKVAIKKIVPFDHSMFCLRTLRELKLLKYFQE
HNVSENIISIVDIIRPPTIEAFKEVYLIQELMETDMHRVIRTQVLSDDHCQYFIYQTLRA
LKALHSADVIHRDLKPSNLLLNANCDLKVCDFGLARSIRTAEQETGFMTEYVATRWYRAP
EIMLTFKQYTKAIDVWSVGCILGEMLSGRPLFPGRDYHHQLTLILDVLGTPTLDEFYAIN
SRRSRDYIRALPLRKKRPFATLYPNASALAIDFLNKTLTFDPKKRLTVEEALQHPYLEAY
HDPEDEPTAPPLDEDFFAFDRQKDEISKEELKRLLFEEINSFNSSTGTTTQS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctgctgtagctctcccgagctccgccacaggtggatcactcaatcctact
gcccctgcttcaacctctgtcaacgccactactactaccagcatcactaacgccccagcc
aacaaaccgaaacaagccggctcccgggccgtgggtgaacctagaagggtccggttcaac
gttgggtctaaatatcacgtcatggatgtcatcggcgaaggtgcctacggggtagtgtgc
tcagccatccatcgcccaactggccagaaggtcgccatcaagaagatcgtcccctttgac
cactccatgttctgtcttagaaccttgcgagaactgaaattgctcaagtatttccaagaa
cacaacgtctctgaaaacatcatttcgattgtcgacatcattcgccctcccaccatcgag
gctttcaaggaggtctatcttattcaagagttgatggagactgacatgcaccgagttatc
agaacccaagtcttatcggacgaccactgtcaatatttcatctaccagactttgcgagca
ttgaaggctctgcattcggcggatgtgatccatcgggatttgaagccatcgaacctctta
ctgaacgccaactgtgacctcaaggtctgcgatttcggattggctcgttcgatccggact
gccgagcaagagacaggcttcatgacggaatatgtagccacccgatggtacagagccccc
gagatcatgctcacctttaagcaatataccaaggctatcgacgtttggtcggtcggctgt
atcttgggcgagatgctctccggacgacctttgtttccaggccgtgactaccaccaccaa
ctgacactcatcttggatgtgcttggtacaccgacccttgacgagttctacgccatcaac
tcccgccgttctcgagactacatccgcgcccttcctctccgcaagaagcgccccttcgcc
acactctacccaaacgcttcagccttagccatcgatttcctcaacaagaccctcaccttc
gaccccaagaaaagactgactgtcgaggaagccttgcagcatccatacttggaggcttac
cacgaccctgaagatgagccaaccgcccccccacttgatgaagactttttcgccttcgac
cgacagaaggacgagatcagcaaggaggaactcaaacgactcctatttgaggaaatcaac
tccttcaactctagtaccgggactaccactcagtcttga

DBGET integrated database retrieval system