KEGG   Puccinia graminis: PGTG_06631Help
Entry
PGTG_06631        CDS       T02226                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pgr  Puccinia graminis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pgr00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 555 aa AA seqDB search
MTLLCKKPQRLSAKFIKRYKYQHRYSSAPASTHVINEGSRIGILGGGLAGLTSAYYLSKQ
LPESNQIIVWEKAHRFGGWVQRSRVDDQNNRTPLVFESGPRSVRPKGLAGLISIELIKDL
KLLDSVIIIPKTHPSAQNRYIYTKNGLQKLPSSMLSLLRSIHKRPISLIPGSLLKDIFHT
TETSRTRPIDDESISEFISRRFGDGIGEELISGMVHGIYAGDYKTLSVRSSLFKSVWELE
RKYGGVLNGLRASQKKRAPIDTNHEEETLRKSLNDHSLQDLVDCSVWGLKGGLETLVTSL
RDWLEKKPNVILKSSESIESVMPSPDGPSTVTSSLGVYGQIDHLISALPPQVLHSCLGPT
LQSRLEVLTTNPSVTVGVVNLAYRSPRRLNPIPPAFGYLIPASIGRELNPHRVLGVVFDS
DMMPGVEEEIGGEELTKLTVMMGGHYYSKQPDSIPTNDELIKQACQTIKDQLGIVQEPFS
AQAQIQKDCIPQYLVGHHRRMSELHHQLAPFNLSLVGSGYSGVGLNDVVKSARDNVINLI
KNGRSTGLEDFDIST
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgactctactttgcaagaaaccacaaaggctctccgcaaaattcatcaagcgatacaaa
tatcaacatcgatactccagcgcaccagcatccacacatgtgatcaatgagggcagtcga
atcgggatcctaggaggcggactagccggcctgacgtcggcgtattacttgtccaagcaa
ctcccagaatccaatcagattatcgtctgggaaaaggcccacaggtttggcggctgggtc
cagaggtcgagggtcgacgatcagaacaaccggactccgttggtcttcgagtctgggcct
agaagcgtcaggccaaagggcttggccgggttgatctctatcgaattgatcaaggacttg
aagctgctcgattcagtgattattatacctaaaacccatccatcggctcagaaccgctac
atatacacgaaaaatggactacagaagctaccctcgtcgatgctttcgttgctaagatcg
atccacaaacgtccgatctcgttgataccaggatcgctactcaaagacatattccacaca
accgaaacatcaagaacacgcccgatcgatgacgaaagcatttccgaatttatttccaga
aggtttggcgatgggatcggagaggaactaatttccggcatggttcatggcatctacgct
ggggattacaagacgctcagcgttaggagtagtctgttcaaatcggtctgggaactcgaa
aggaaatatggcggtgtcttgaacggattgagggccagtcagaaaaaacgagctccgatc
gatacaaatcatgaagaagaaacacttcgtaaatctctcaacgatcattctcttcaagat
ctagtggattgcagtgtctggggcctcaagggcggtctcgaaacgctggtaacctctttg
agagattggcttgaaaagaaaccgaatgtgattctcaagtcgtcagagagcatcgagtcg
gtgatgccatctcctgatggcccttccacagttacctcgtctcttggagtctatggacaa
atcgatcatctgatctccgcccttccacctcaagtcttacactcctgcctgggaccaacg
cttcagagccgattggaagtgttgaccaccaacccgagtgtgactgtcggagtggtgaac
ctagcttaccgatcccctcgccggctcaaccctatcccaccggcgtttggctacctgatc
ccggccagcattgggcgagagctgaacccccatcgagtgctaggagtagtctttgacagc
gacatgatgccgggagttgaggaggaaatcggaggggaagagttgacgaagttgacggtg
atgatgggcggccattactattccaagcaacccgactcgatcccgacaaacgacgagctg
atcaaacaagcctgtcagacgatcaaagaccaactggggatcgtccaggagccattctcc
gcccaagctcagatacagaaggattgtatccctcaatatctcgtgggccaccatcgaagg
atgtctgaactccatcatcaactcgcacctttcaatctctccctcgtcggctcaggctat
tctggcgtcggattgaacgacgtcgttaagtctgccagagataatgttatcaatctgatc
aaaaatggccgctcaactggattggaagattttgatatctcaacatga

DBGET integrated database retrieval system