KEGG   Puccinia graminis: PGTG_06935Help
Entry
PGTG_06935        CDS       T02226                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pgr  Puccinia graminis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:pgr00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 869 aa AA seqDB search
MNSTPAEPLRSRKLLLTQTNGNTHPPQQWSTANQEQQKQLTSRNKSRLSRLGGGLELIGT
KQQREPLLIISLTILAGLIRTWKIARPASIVFDEVHFGGFASKYIRSEFFMDVHPPLVKL
LFALVGWLSGYDGTFEFKEIGSDYSDRVPYIQMRLVPALLGVAIVPIAYLTLRMFHQRPL
SATLGALLITFDNALIVQSRFILLDSPLLFFTALSIFFHTGFCNEDYKRAFTRAWWSWLS
LTGLSLGLVLSSKWIGLFTIGAIGLVTIKQLWELLGNLRVPLPLLIRSFFARLLCLALLP
LLVYMLIFRIHLAILSGSGDGDAFMSSEFQQTLRGHHMPDTFAEVLLGSNVTIKHTNTLG
GYLHSHAQFYPTGSHQQQITLYPHHDDNNVWTVLGRLADDIDLVHRKPPDFYYKNRVPVN
GSTFIRLNHPLTDKRLHTHDIRPPVSEVDYQNEVSGYGFPNYPGDANDEWIIEIISKESD
LKTDPMSAKQVRALRTKFRLRHSLQNCYLFSHKVRLPDWGFGQQEVTCNRNPTLASSLWY
IESNYHPLLEQDPKARKVNYHRPSFWSKFWELQTVMWQTNKALVQHHAYSSSPISWPILK
RGMNFWAKDHRQIYLLGNPFIWWLSTAAILFYLITKSLLILRIKRGYHGEARNLNVMKYD
GISAYLVVGWATHYLPFYLMTRQVFLHHYFPSLYYSIFQVCTVFDFATSRVSPKARLKTF
ALILIMAVWSWSIFKPVTYASRWTRSACERARWKRSWDFGCHDFPELVDEYDEDGEEPMT
EDGWMRNASEHKAGLVQAVHNRFKLLEPIMNVFQQASSDEMPEPSPKAPLPAEHVTSFSN
APFQASLANGQRKSPPGPRLRRSHLKEID
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcactccagccgagccacttcgatcacgcaaactcctactaacacaaaccaat
ggcaacacccacccaccccaacaatggtcaacagcaaaccaagaacaacagaaacaactc
accagcagaaacaaatcaagactcagtcgactgggcgggggactagaactcataggaacc
aaacagcaacgagaacctctcctgatcatcagcctcaccatcctggctggtctgatcaga
acctggaagatcgcaagaccagcgagcatcgttttcgatgaagtccatttcggtggtttc
gcctccaaatacatccgttcggaattcttcatggacgtccatccgccactcgtcaagcta
ctgttcgctctagtgggctggttatctggatacgatggaacattcgaatttaaagagatc
ggaagtgattattcagatcgagtaccgtacattcaaatgcgtctagtacccgcactctta
ggcgtagccatcgtacccattgcctatcttactctgaggatgttccaccaaaggccttta
tcagcaactctcggcgcacttcttatcaccttcgataacgccttgatcgtccagtcaaga
ttcatcctactcgactcgcccctactcttcttcaccgctctttcgatcttcttccacacc
ggcttctgcaacgaggattacaagcgagccttcactcgcgcctggtggtcctggctatcc
ttaactggcctaagtttgggcttggtgctctcctcaaaatggatcggcttgttcacgatc
ggcgcgatcggactggtgaccatcaagcaactctgggagctcctcgggaacctccgtgtg
cccctcccgctcctcatccgttccttcttcgcccgtctgctctgtctcgccctcctgccc
ctgctcgtctacatgctcatcttccggatccatctcgccatcctctccggctcgggcgac
ggggacgcgttcatgagctccgagttccagcagaccctacgcggccatcatatgcccgac
accttcgccgaggtcctgctcggctcgaatgtgaccatcaaacataccaacaccctcggc
ggatatctccactcccatgcccagttctatcccaccggctcgcaccaacaacagatcaca
ctctatccacaccatgacgataataatgtttggactgtcctcggaagactcgctgatgat
atcgatcttgtccatcgtaaacctcccgacttctactataagaatcgggtccccgtcaat
ggatctaccttcattcgtctcaatcatcctttgaccgataagcgcttgcatactcatgat
atcagacctcctgtctcagaggtagactatcagaacgaagtctctggctacggattccct
aactatccaggggatgcaaatgacgaatggatcatcgagatcatcagcaaagagtccgac
ctgaagactgatccgatgtcggctaagcaagtccgggcgcttcggaccaagttccggctc
cgccattcgctccagaactgttacctcttctctcacaaggtccgcttgcccgattggggg
ttcggccagcaggaagtcacctgtaatcgcaaccctactcttgctagctctttgtggtac
atcgagtccaattatcatcctttattggaacaggatcctaaagctcgcaaagttaactat
catcggccgagtttctggagcaagttctgggaacttcagacggttatgtggcagactaat
aaggccctagtccagcatcatgcgtacagttctagtcctatctcgtggccgatcctgaaa
cgagggatgaacttttgggctaaagatcatagacagatctatctcctgggaaatcctttt
atttggtggctctccacggccgctatcctcttctatttgatcactaaatcgttgctgatc
ttgaggatcaagagaggttatcatggggaagcaagaaatttaaatgtgatgaaatacgat
ggtatctcggcgtacttagttgtcggctgggcgacgcattacttaccattctacctgatg
acccgtcaagtctttctgcaccactacttcccatcgttgtattactcgatcttccaggtc
tgtacggtgttcgactttgcgacgagtcgggtgagccctaaggcccggctcaagaccttc
gctctcatcctcatcatggccgtctggtcctggtcgatcttcaagccggtcacctatgcg
tctcggtggacgcgctccgcttgtgaacgcgctagatggaaacgctcgtgggatttcggg
tgtcatgatttccctgagcttgtggatgaatatgatgaagatggagaagagccaatgaca
gaggacgggtggatgcggaacgcgagtgaacacaaagccggcctcgtccaagcggtccac
aaccgattcaagcttctggagccgatcatgaatgtgttccagcaagccagctcggacgag
atgccggaaccttcgcccaaagcgccgctccctgccgaacatgtcactagtttctctaac
gctccgttccaggcttctctcgctaacggccagcgtaaatctccccctgggcctcgtctt
cgcaggtctcatcttaaggaaatcgattga

DBGET integrated database retrieval system