KEGG   Puccinia graminis: PGTG_07306Help
Entry
PGTG_07306        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PGTG_07306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1108 aa AA seqDB search
MATMEPINMTIEENLSTDNDDTNDMDAEGELVDSEDEQQELIEQQQQQQYHSTSSSQPSS
PSFNTALTEQEQEPIQDIINQKPSSQSTVYEEEEAGQHHHSILIEPIHHPLQDSSPKMAP
VRLNKKTTTKRSISTSNKTQLKLIKSQPVNHRSNSKQKRCNSKLLPIVMAEQQILEQHQQ
QQQKACKQVYNQPNRQQPQQQPTSPVTRPKLGVIGGRRAPREGWCSFCSREGGFDDLNGN
MVRGEIPISLVTQSLNPSNDPSHNNSNNLSLEPLSIIPSSSTSSTSRRRGKGEMVSCWEC
GQSGHFSCMELNNLTIKSHAKSYPWLCLECRRCHGCDKKGDDDQNMLLCAVCDRGWHGEC
LNPPLRTVPSGDFTCPFDHQSTQCIPPLPDSVTLPPFSPSQIPLGLPTIPNNTPLKANGI
TSKPNNRATVNKKRKMKNLPSDDDDESMGFVDKETGDPTEMRSSKKLTAGKPRNGTKGTV
KRLNTLTSTTSSSLSPLRKQTSSLTLDGTALDPFSNHPDGSDENIDDAQEEEEQGGDSLD
PPKPTNPFEGVLNEDEAAIGDRNITEDDLTRFNQSLERSKARMETSAGESADRTNAAAPS
PSMVAVPSPSSGSLETPRLAAVRERRSGLHGTSPSGTRGRITPTVFTPEMEIDEVSSNSS
THHEEVVKKKEAARPSRRTKKNETHQTSIIKSIRFGEYEIDVWYQAPYPEEYSKLPGGRL
WICERCLKYFKTEFEISRHRMKCKNFYPPGDEIYRDNDERHGVRIQIFEVDGRKNKMYCQ
NLCLLSKMFLDHKTLYYDVDPFLFYVITQTSLLSNHPSSIDSSPSNPRCQFVGYFSKEKR
SPTNNVSCIMTLPVLQRKGWGNLLIDFSYLLSKKEKRVGTPEKPLSDLGLLSYRNYWTLS
ISKFLMSCDPSNEEEQITLEDIANQTSISLLDVYYTCRHKNWIHEVKPSPLSNTSVPVVH
HPVVPKRKSHNWNGRRKPPSSVHASPAPVHASQARPNQPGGSSNTNPSAPSSKTNSSLII
DEKAIPKYYNIRWDPLEVSQIVEKSAQKDLLCLKPEKLVWSPFLTTRAQGLSIDVSPIAI
PLIPNTDPYQFSNKKLASSSVDQSPLIS
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgatggaaccgattaacatgacgatcgaagagaatctctcaaccgataatgac
gatacgaacgatatggatgccgaaggagaactagtagactcagaagacgaacaacaagaa
ctaatcgaacaacaacagcagcaacagtatcacagcacctcctcatctcagccatcctca
ccatcatttaatactgccctaaccgaacaggaacaagaacccattcaggatatcatcaac
cagaaaccatcatcccaatcaactgtatatgaagaagaggaagcgggacaacatcatcac
tcaatcctgatcgaaccaatccatcacccactacaagattcctcacccaagatggcacca
gtcagacttaacaagaaaacaacaaccaaacggagcatctcaactagcaacaagactcag
ctcaaattaatcaaatcacaaccagtcaaccaccgatcaaacagcaaacagaaacgatgt
aattcgaaactattacccatcgtcatggctgaacaacagatcttagaacaacaccagcag
cagcagcagaaggcatgtaaacaagtgtacaatcagcctaaccgacaacagccacaacaa
caacctacctcaccagtcactcgtcccaagttaggagtcataggcggacgacgtgcacca
cgagaagggtggtgcagcttctgctccagagagggcggattcgacgaccttaacgggaac
atggtccgcggcgagattccaatctcactcgtcactcaatcactcaacccctcaaacgac
ccatcccacaacaacagcaacaacctctctctcgagcctctctctatcatccccagctct
tctacttcctcgacctcccgccgtagaggtaaaggcgaaatggtaagctgttgggaatgt
ggtcagagtggtcattttagctgtatggaattgaacaacttgacaatcaaaagtcacgcc
aaatcatatccttggctttgcctagaatgtaggcggtgtcatgggtgtgataagaaaggt
gatgatgatcagaatatgttattatgcgcggtgtgtgatcgtggctggcatggggaatgt
ctgaatccgcctctaaggaccgtaccttccggtgacttcacctgtccctttgatcaccag
tccactcaatgcatacctccccttccagactcagtcactcttccccctttttcgcccagc
cagattcccctcggcctcccgacgattcccaacaatacccctctcaaagccaatgggatc
acctccaaacctaacaatcgagcaacagtcaacaagaaaagaaaaatgaaaaacttgccg
tctgatgatgatgatgagagcatgggctttgttgacaaggaaacgggcgatccgactgaa
atgcgatcgtctaagaagctcactgctgggaagcccaggaatggcaccaagggtacagtc
aaacggctcaatactcttacatccactacttctagtagtctttcgccgctgagaaaacaa
acatcgagtttgactctcgacggcactgctcttgaccctttttcaaatcatccggatggg
tcagatgaaaacattgatgacgcacaagaagaagaggaacaaggcggggactctctcgat
ccacccaagccaacgaatccgttcgagggcgtgttaaacgaggatgaagctgcaattggg
gatcgaaacatcaccgaagacgacctgacaaggtttaatcaaagtctggaaagatccaag
gctcgtatggagacttcggctggcgaatcagccgacagaaccaacgctgccgccccttcg
ccctctatggttgcagttccctctccatcaagcggtagtttggaaaccccgcggctggca
gccgtccgagagcgcagaagcggcttacatggcacaagtccatcgggcacaagagggcgg
atcacaccgacagtattcacacccgagatggagattgatgaagtctcctcaaactcatcg
acccatcacgaagaagttgtcaagaaaaaggaagcggctcgtccgagtaggaggaccaag
aaaaatgaaacccatcagacgagcataatcaagtcgatccgatttggagagtatgagatc
gatgtatggtatcaagcgccctaccctgaagagtactcgaaactgccaggtggcagatta
tggatctgtgagcgatgtctgaagtacttcaagaccgagtttgagatctctcggcaccgt
atgaagtgtaagaacttttatcctccaggggacgagatctatcgagataatgacgagcgc
catggggtacgaattcagatcttcgaagtagatggaaggaagaataagatgtattgtcag
aatctatgtctcttgtcgaaaatgttcttggatcataagacactctactatgacgtcgac
ccgttcctcttctacgtgatcactcaaactagtctcctctccaatcacccctcttctatc
gattcatccccctctaatcctcgttgtcaattcgtcggctatttctctaaggaaaaacgt
agcccaactaataacgttagttgtattatgactcttcctgtccttcaaaggaaaggctgg
ggtaatttgttgatcgacttcagttatctattatcaaagaaggagaaaagggttgggaca
cctgagaaaccactgtcagatctaggcttacttagttatagaaattactggaccctatca
atctcgaaatttttaatgagctgtgatccaagcaatgaagaggaacagatcacgttagaa
gacatagcgaatcagacctcgatttcgttattggatgtctattatacctgtcgacacaag
aactggatccacgaagtcaagccgagcccgctttcaaatacttcggtcccagttgtccat
cacccggtggttcccaaacggaaatcgcacaactggaacggacgtcgaaagccgccgagc
tcagtgcatgcatctcctgctcccgtccatgcttcacaagctcgtcccaaccagcccgga
ggctcctctaacaccaatccatccgccccttcttcgaagaccaactcatcattgatcatt
gacgaaaaagcaatcccgaaatattataatatccgatgggaccctctggaagtttcccag
atcgtcgagaaatcggcgcagaaagatttgctctgtctcaaacctgagaagctcgtgtgg
tctcctttcctgaccacgcgtgctcaaggtctgtcgatcgacgttagcccgatcgctatc
ccccttatccctaatactgatccctatcaattctctaataaaaaattggcctcctcttct
gtcgatcaatctcctttgatttcttaa

DBGET integrated database retrieval system