KEGG   Puccinia graminis: PGTG_07938Help
Entry
PGTG_07938        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pgr  Puccinia graminis
Pathway
pgr00052  Galactose metabolism
pgr00500  Starch and sucrose metabolism
pgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PGTG_07938
   00500 Starch and sucrose metabolism
    PGTG_07938
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PGTG_07938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 10533396
NCBI-ProteinID: XP_003326108
UniProt: E3KBJ1
AA seq 780 aa AA seqDB search
MGDHPPLLPKRVNRLVALILAGNWIDLAVCLSGGSSNQRLWFNQNAIDSFSAHKTTPLLS
SYNAFHNLLNNGTICRMDRSKPPDLQELVSCRNSSMFNVWRPKARVIAPRGWMNDPMGMF
QTRNGNFHVGYQCSPQHLGWANISQCSASTSDFVEFDDYRSWEDPVTISPSQIYDIRGVF
DGVVVKDGWNGHPTLIYTSAYVGEFAPRCEPPEVEGVETQSVAYTEDDGNTWTKLNFGAS
GNPIIYHWPEKNLSGFRDPFVFESKEFSKFYDHSSNAHQLYPDSNEQKPRGDKYLLLSGG
IRVKADPINGGPRVFLYRQTKENDLRDWTYLGPILSFTAEYNQTSEWTGGNGINFEATGF
STIDEQGLAPDFDSSNVTNQLNIFTTGTEGARNFTHMDYWPVWHAVNWNYNVTGGHVRGE
VDFSGVVDWGRAYAFAQFSAGKRQLIVGWVYEDDEFNVLTHQRGAQGAFTLFREMFVKVI
RNIHPGALKVPEHAPSWTTKIEKDGSHSVVTFGQRILPAIKAAFYDRSEVTKLNDRALNI
TSTSVAQHQEGGLPTSLVAFEKQPKDRYYVIRAQLDFFPEQHVPADEPLKRPSALRGGFR
ILSGKFERTDIFYDPNQEYLVIDRSHSSTIPSYGNSTEQAKHRLWPVLNPVTNNTNYESL
NLTIVVDNSVLEVHANERTIITTRVYPWCKDSVNVEYFVQGPEVALSQAKPADSATSEPD
SHHLDPKPVSESHSQAVHFSQVELWDGLVNAWPNRPSDTSLPGLYSYNITSTVYGLWPDL
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaccatcctccacttctccccaagcgggtgaatcgcctagttgcattaattctc
gccggaaattggattgacctggctgtgtgcctttcaggggggagttctaatcagcggctt
tggtttaatcaaaatgcgattgatagtttcagtgctcacaagactacacctcttctgtct
tcatacaatgctttccacaatctgctaaacaatggtaccatatgccgtatggaccgatcg
aagccacctgatcttcaagagctcgtaagctgtcgaaattcgtccatgttcaatgtgtgg
aggcctaaagcacgcgtgattgctccgaggggctggatgaatgatccaatgggaatgttc
caaacaagaaatggtaactttcatgttggttatcaatgtagcccacagcacttgggttgg
gcaaatatttcgcagtgctcagcttcgacaagtgattttgtcgagttcgatgattatcga
agttgggaagacccggttactattagtccatcccagatatatgatattcgaggtgtcttt
gacggcgttgtggtaaaagacggatggaatggacatccgactctcatctacacctcagcc
tatgttggcgagtttgcccctcgatgtgagccaccagaagttgaaggcgtggaaactcag
agtgtcgcttacacggaagatgatggcaatacatggaccaagttgaatttcggagcaagc
ggcaacccgataatttaccactggcccgagaaaaatctatcgggcttcagggatccattt
gtgtttgaatccaaggagttctcgaagttttacgatcatagttccaatgctcatcagctt
tacccagattctaacgagcaaaagcccagaggggacaaatacttgcttctgagtggtggc
attcgcgtaaaggcagacccaataaacgggggacccagggtattcctctatagacagact
aaagaaaacgacctccgtgactggacttacctcggtcccatcctatcattcactgccgaa
tacaatcaaactagtgaatggaccggcgggaatggtatcaactttgaggcaactggattc
agtacgattgatgagcaaggtttagctccggatttcgactcatcgaacgtcacaaatcag
ttaaacatcttcacaactggaacagagggtgcacgcaattttacacacatggattattgg
cccgtttggcatgcggttaattggaactacaacgtcacgggtggtcatgtcagaggagag
gtcgatttttctggagttgttgactgggggcgagcatatgcatttgcccagttctcagca
gggaagcgtcaattaatcgtgggttgggtatacgaagacgacgagtttaatgtcttgact
caccaaagaggggcacaaggagctttcacattgtttagggagatgtttgtcaaagttatc
cgcaacattcaccctggtgcactcaaagttccagagcatgcccccagctggactacaaaa
attgaaaaggatggcagtcattccgttgttacctttggccaacggatcctacctgctatt
aaggccgcattctacgaccgctcggaggtcacgaagttaaatgatcgtgccttaaacatc
acttccacatctgtcgcacaacatcaagagggtggtctcccgactagcctcgtggcattt
gagaagcaacccaaggaccgctactatgtcatccgcgcccaactcgattttttccccgaa
cagcatgtcccggccgatgaaccgttaaaacgaccctcggccttacgtgggggatttagg
atattgtcgggaaaatttgaacggacagatattttctatgatcccaaccaagaatacttg
gtcattgaccgatctcatagctcgaccattccatcatatggaaactcaactgagcaagcc
aagcacagactttggcctgtcttgaaccctgtcacaaacaacaccaactacgaatccttg
aacctgacgatcgtagttgacaacagcgtcctcgaggtccatgctaatgagcgcactatc
atcacaacccgggtatatccttggtgcaaagattcggtgaatgtcgaatactttgttcaa
gggccagaggttgccctcagccaggctaaacctgcagatagcgcgacttcagagccagat
tctcaccatttagaccctaagcccgtgtctgaatcccactctcaagcagtccatttttca
caagttgaattgtgggatggcttagtgaacgcgtggcctaatcgcccaagtgacactagc
cttccaggcctttacagttacaacatcaccagtaccgtttacgggttatggcctgatcta
taa

DBGET integrated database retrieval system