KEGG   Puccinia graminis: PGTG_07951Help
Entry
PGTG_07951        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
pgr  Puccinia graminis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PGTG_07951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1883 aa AA seqDB search
MATEYIPDLFIRLFDFLQDLIAKPDPSLLPRLRLELDRARPFLIQLFDKRPRNPKEAEQI
RKGQFVYQATLHSHTPDFTHEALYLSEQLELSENQCAILLQHGMSRKARYGRPNADSAVI
IYYQERSALLNFLKLIFQPADPENDDCGLSEELERFRNSLVNSRSASIKQDTWISKVLKE
IEQSKNQIIKLKTQLTSSSTSNTYGAQSMNNTTGAFNFGSISTTPQRAAEKSNEVVVKFS
DEIVQRMLEQHQSERRELGQILYLIAFSRLLSKENLLSLVDYLAGMNSEDPLICHFLMTF
LAAMDVECSSSTEAEYNYFTELWNDVPFLQTMTERLNQKRWLVRQVKAVALLQWCLFLGS
AYQQDPRLEHETQIWEDIIDQMVMSAIRNGAFPFMVSDLLAFKKKDLLEETPPQVLGPRT
EDALRVATADDLLGIEEGFRSEVVAQIDRLMITFVTSLQSVLRRLRNQEEDVHVSMRYHS
MTQTSNPDMSESLPSPHHDIEALFEVIAAIHRNTPDSALVYWGVGENQDNIDDPTLTSGR
STKLTGFVRWASECRQLGMVQSFYEMLASLATGPRCSDLAYSFLMSGSSDDGTSGMNSTM
SRIADAMGRINLLTCSWSSIFGQFQYYIQALQALSLQKNSTPENRQLFPPEVSILKKYAK
VIRQIVRYSSIAQATLYDHQKYRPIQTLFALAACPIPLDLKAELLLAIAAFAAPGSKISA
DIARKCWLTLEHSQILSTNSWDLPADFGAAGALSLTSGELIRTGILAELEEVEATNQVYP
GSTAFIRLLVALIHPPARRSPVKKGEELELQSIPENLGVSSRSPGIEPYLRFVVDEVFRK
VGSRDFLHQEERYQVFEVCLAFIERCLTSYEIGPFLATSTLSNAHSGSEAHSRAVLAVVT
HPGFEIMLRILNNTELTRQVFETLLNGPRFVENEPQKSDITCRCVLRALRIVHRVIELQQ
PFLDGVLPHVLNHAAANIPHDRVIWARSAQSLDQHIFHSSSMVISIAVLVGCVEDEEVAY
LAVKLLTHIAESTFFSAADHFHGQYPGRMNRLLGLLDSSEESLLILGNFMGRLEAAGSTF
RNIDDDDFVVDTSGDLEERDMSRISSAIRSAILDLLLQNTQPHRAAPNVAHYLLGFDARA
SKDTMALADPRSPDAKLSCFHAILNLLRMGQASSNSEESEGEFSLLERDPILAEKAYRVI
RQLCLHEYSCKPVSRYLRNTEQYFIAQASALPLSIPANHSIAGGQLILSSGKVIETTCSE
IVATLHSTSWVLETISLELNILTQQAQRERATDLLLILFESASSPNQSKSILDQVGSPDQ
SLPRMQELFLYLDFAWKNNTTIEPRPLNFFATLNFDQCCVIDSTGCQLFDLGAILSMLGA
TRQEIKRRGLLNTAAQQAEMQEEIKFVIESIVVENQRRQIASAQYHMLRSWSTLLRLTLS
RAFHLIPAENRHIFLLDLLGSVLSKLVEGQVDSDSAELLSEIVVALMIKLRHEGTQLGSL
ATGEAAQAFPFDRMIPILKTIVQSIVLSNTSNIIRGNLYASLLGFLQHVYATSNADSAAL
QCFSPQDIMKLTDALLPPSDAASTIVSQWSSSRSTLEANTIAMISTAFDRLLPVISKDAI
MGSEVWKSVAFTALDSLLMLSDRSRSGSKLMAVLWRNGFMKNFVDFVKDAEGDLLAVLEP
DPESLNALYVYETQMAFLLRVASSQAGAEKLIDAKLLVRLGQCNYLSSSPQSLSPHEEFD
MFIPSASERYHQLLLPALQLVACVLISLGSESGLATREALSFINAQREMIMTCIRSASML
TSSIGIQELLLITSILRIALPAVGDQEIASSTDFGALHTGILAIANVVCGSQAWMNNIIP
ATELERENVARIVPGNENSAQLF
NT seq 5652 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgagtatattcccgacctgtttatcagacttttcgacttcctccaagatctc
atcgccaaacctgatccatcgttgctaccccggctgcggttagagctggatcgcgcccga
ccgtttctcatccaactgtttgataaacgacctaggaatccgaaggaagcagaacagatc
cggaaaggccaatttgtttatcaagctaccctgcacagccacacacccgacttcacccat
gaggcactctatctctctgaacaacttgaactgtccgaaaatcaatgcgctatcctttta
cagcatgggatgtcgcgtaaagcgcgttatggaaggcccaacgcggacagtgctgtaatc
atctattatcaggagcgatcggccctactgaactttcttaaacttatctttcaacctgcc
gatcctgaaaatgacgactgcggtctgagtgaggaactcgagcggttccgaaatagtctg
gtgaacagtcggtcagcttcaataaaacaagacacgtggatctcgaaggtgctcaaagaa
atcgagcaatccaagaatcaaatcatcaagttaaaaactcagctcacttcaagttcaact
tccaatacctatggagctcaatcgatgaacaacactactggagcttttaactttggatct
atatctaccacccctcaaagagctgcggaaaaatccaacgaggtcgtcgtcaaattcagc
gatgagatcgtccaaagaatgctagagcagcatcaatccgaaagacgcgaactcgggcaa
attctatatctgatcgcattttctcgattgctcagcaaggaaaaccttttgagtctagtc
gattatcttgccggaatgaactctgaggatccgttgatttgccatttcttgatgaccttc
cttgcagcaatggatgtcgagtgtagttcatcgacggaagccgagtataactatttcacg
gagctgtggaacgatgttccttttctgcagacgatgactgagcgactgaatcaaaagcga
tggctggtccggcaagtcaaggcagtcgcattgctgcagtggtgtttatttcttggctca
gcctaccagcaagatccgcgactcgagcacgaaacacaaatttgggaggacattatagat
cagatggtcatgtctgcgatccgcaatggcgcgtttccattcatggtttccgacttattg
gctttcaagaagaaggatttactagaagaaacgcctcctcaagtcttaggaccgcgaacg
gaagatgctttacgagtcgccactgcagatgacctgttgggtatcgaggaagggttcaga
tcggaagttgtcgcccaaatcgaccgtttaatgatcacttttgtcacttcgcttcaatct
gttctacgtcgattgcgcaatcaagaagaagatgtacacgtctcaatgcgctaccactca
atgacccaaacatctaatcctgatatgtcagagagccttccatcacctcatcatgacatt
gaagccctgttcgaagtcattgctgccatacatcgcaacacccccgattctgcattggta
tactggggagtaggcgaaaatcaagataacatcgatgaccccacgttgacgtcgggacgc
tcaaccaaattaactgggtttgttagatgggcctccgaatgccgtcaactcggcatggta
caatcgttttacgaaatgctggcgtctttagccacgggcccgcgctgtagtgatctagct
tactccttcctcatgagcggctcctctgacgacggaacgagtgggatgaattctacaatg
tcccgcattgctgatgctatgggcaggatcaacctcttgacttgctcttggtcatccatc
tttggccaatttcagtactacatacaggcacttcaagcactatcattgcaaaagaacagc
actcccgaaaacagacagctcttcccgcctgaagtgtcaatactgaagaaatatgccaaa
gtcatccggcaaatcgtccgttattcatcaatcgcccaagctacgctctacgatcatcaa
aaatatcgacccatccagacccttttcgctttggctgcctgcccgattccgttggacctc
aaggctgaactactattagccatcgccgcttttgccgcccccggtagcaagatcagtgct
gatattgcccgcaagtgttggcttacgcttgaacatagtcaaatcttatcaacaaactca
tgggatctacctgctgatttcggcgctgcgggggcgctctcattgaccagtggtgaattg
attaggaccggtatattggctgagctggaagaggtcgaagcaaccaatcaagtctacccc
gggtccacagcttttatccgtctgttggttgctttgattcatccaccagcgcgccggtca
ccagtcaaaaaaggggaagaactggagctgcagtccatccctgaaaaccttggggtatca
tcccgatctccaggtatcgagccttatttacgattcgtggtcgacgaagttttccgaaag
gtgggatcgcgtgatttcttgcatcaagaagaaagataccaggttttcgaagtatgtctg
gcattcatcgagcgatgtttaacatcatacgaaatcggcccatttttagcaacttcgaca
ctttcgaatgcgcactcaggcagtgaagctcattctcgagcagtattggccgtagtaacg
catccagggtttgaaatcatgcttcgcatactcaacaatactgagctcacgcgtcaagta
tttgaaacccttctcaatggacctcgctttgttgaaaatgagcctcaaaagtccgatatt
acctgtcgatgtgttctccgtgctctcaggatcgtccaccgggtcattgaactacaacag
cctttcctagacggcgtcttacctcacgtactcaatcacgcagccgcaaatatcccccat
gaccgagtgatatgggcacggtcagctcaaagcttagatcagcacatctttcactctagc
agcatggtgatttcaatcgcagtgttggtggggtgtgtggaggatgaggaagttgcctac
ctcgctgtgaagcttttaactcacattgccgaatccacattctttagtgccgctgatcat
ttccatggacagtatcctgggcgaatgaaccgcttactgggcctattggactcttcagaa
gagagccttttgatcctcggtaactttatgggtcggttagaagcagccgggtcaaccttt
cgcaacatagatgatgacgattttgtagttgacacatctggtgacctagaagaaagggat
atgtctagaatttcctcggccatcagaagtgccatcttggatcttttgctccagaatact
caacctcatcgagctgcccctaatgtggcacattatcttttgggattcgatgcacgagcc
tcaaaagatactatggctttagctgaccctagatcgcccgatgccaaattgtcttgtttc
cacgctattctcaatctgctccggatgggtcaagcctcaagcaattcagaagaaagtgaa
ggtgaattctcgctgctcgagagggatccaatcctggctgaaaaagcctaccgggtcatt
cgacaactctgtctacacgaatattcctgcaagccagtctctcgctacctacgaaatacc
gaacaatatttcatcgcccaagcaagtgctttaccgctatcgataccggccaaccactcc
atcgcgggtgggcaactcatcttgagcagtggtaaagtcattgagaccacctgcagtgag
attgtagccactttgcattcgacatcctgggttttggaaacgatttctctggagctcaat
attctcacgcaacaagctcagcgagaacgcgcgacggacctgttgctaattttattcgaa
tctgcctcttccccaaatcaaagcaagtcgatcttggaccaagttggtagtccagatcaa
tcccttccaaggatgcaagaattgtttttatacttggattttgcctggaagaacaacacg
acaatcgagcctcgcccattgaacttttttgcaacccttaactttgatcagtgttgcgtc
atcgatagcactggctgtcagctatttgatttaggtgcaatcctcagcatgcttggagct
acccgacaagagattaaacgtcgtggccttttgaacactgctgcgcagcaggctgagatg
caggaagaaatcaaatttgtcattgaatctattgtcgtcgaaaatcaacggcgacagatt
gcctcagctcagtaccatatgttacgctcatggagcacattacttcgcctgactttgagc
cgggcttttcacttgattccagccgagaatcgacatatctttttgctcgatctgctgggt
tcagttctgtcgaagttggtagaaggtcaagttgactcagattccgccgagctgttgagc
gagatcgttgtcgctctgatgatcaaattacgccatgaaggaactcaattaggatcccta
gccactggcgaagcagctcaagctttccccttcgatcgaatgatacctattctgaagaca
atcgttcagagcatcgtcctttcaaacacttcaaacatcatccgaggcaatctatacgca
tcattactaggatttcttcagcatgtctacgctaccagcaatgctgattcagcagcttta
cagtgcttctcgccacaagacataatgaagctgaccgacgcactgctccctccatctgat
gcggcctccactattgtcagtcaatggagttcttctcggagcactctggaggccaatact
attgccatgatatctacagcttttgatcgactgctaccagtaatatccaaagatgctatc
atgggtagtgaggtgtggaaatcagtcgcttttaccgctctggactcgctcttgatgtta
tccgatcgctcaagatctggctctaaattaatggctgtcttgtggaggaatggatttatg
aagaactttgtagactttgtgaaagatgcagaaggtgatcttctcgcagttcttgagcca
gacccagaatccctgaacgccttgtatgtctacgagacccaaatggcattcttgctacgc
gtggcctcaagtcaagcgggtgctgagaaactcattgacgcgaagttgctagtgagactg
gggcagtgtaattatctgagtagctcaccgcagagcctgtctcctcatgaagagttcgat
atgttcattccatctgcgtcggaaagataccatcaactactgcttcctgcactgcaattg
gtcgcatgtgtcctcattagtctaggctctgagtccggtctggctactcgggaagctttg
agcttcatcaacgcacaaagagagatgatcatgacatgcattcgctctgcgagcatgctg
acatctagcatcggaattcaagagttactccttattactagtattttaagaatagctttg
ccggccgtcggtgaccaagaaattgcctcctctacggatttcggtgcactccacaccggc
atccttgccatcgcgaacgttgtgtgtgggagtcaagcttggatgaataacattatacct
gcaactgaactggagcgggaaaatgtagcgcgaatcgtaccaggtaatgaaaattccgct
caattattttga

DBGET integrated database retrieval system