KEGG   Puccinia graminis: PGTG_08012Help
Entry
PGTG_08012        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pgr  Puccinia graminis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pgr00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pgr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 327 aa AA seqDB search
MFIHSQIRNNLLAVALFSFFTWAQNSVPPSGALIVRQGKAGKGEYATISAAVAALKGLTG
PKTIFVYPGTYSEQVKLVYDSPLILQGYTTDPTSATSNQVNVQVAVSAAQAGSNSKSATI
WAYSDDIRISNFNVINSFGTGTDTQALALASTGKRQAFKYCTFSSFQDTVEVEGLSYFYG
CRVEGAVDFIFGPGSAWFTNSILAVKAASKPVVTAQRNRAGGKTSIVIDNSQFISAGAKA
GSTYLGRPWSEYASVVVQSCSLSDIINPAGWSAWSPPSDPRTSHVSFQEYKNSGPGANSK
ARQIGTQRSSKVEIAEVLGSDYGVWAN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttatccactcgcagatacgaaataacctcctggcagtcgccctcttctcgttcttt
acctgggcccagaatagtgttcctccatccggcgcgttgattgtgaggcagggaaaggca
gggaagggagaatacgccactatttcagccgctgtagctgctttgaaggggctcaccggc
ccaaagactatcttcgtctatcctggtacttattccgagcaagttaaactagtctatgac
tctccattgattttgcaaggctacaccaccgatcccacatccgcgaccagcaatcaagtg
aatgtccaggtggctgtcagtgcagcgcaagccggtagcaattctaaaagcgcgacgatt
tgggcttacagtgacgacatccgtatttcaaacttcaacgtcatcaactcatttggaaca
ggtactgatactcaggcgcttgctttggcatctacgggaaaaagacaagctttcaaatat
tgcaccttcagtagctttcaggatactgtcgaagttgaaggcctatcttatttctacggg
tgccgtgtagaaggtgcagtcgattttatatttggtcctgggtctgcttggtttaccaat
agtattttggctgtcaaggctgcatcaaaacctgttgttactgctcaaaggaatcgtgcg
ggagggaaaacgtccatcgtaatcgacaactcacaattcatttctgctggcgctaaagca
ggatcaacttatctgggcagaccgtggtctgaatacgcaagtgtagtggtccaatcatgt
tccctaagtgacatcatcaacccagcgggttggagtgcttggagccctccaagcgatcca
cgtacttcccacgtgtcatttcaagaatacaaaaactcgggacctggtgcaaactcaaag
gctcgtcaaattggtactcagcggtcaagcaaagtagaaattgccgaggttttaggatct
gattacggtgtctgggccaattga

DBGET integrated database retrieval system