KEGG   Puccinia graminis: PGTG_08350Help
Entry
PGTG_08350        CDS       T02226                                 

Definition
S-formylglutathione hydrolase
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
pgr  Puccinia graminis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1410 aa AA seqDB search
MVKEVEMDEIPSPQEQARLYHSFRSIRMATDQTWYLIHQQWFNTWSSSIGIATDDSTAAG
TTTTTTDIPSIDNSDLLDHENQLRFGISIGIDCEIIPEEFWNLLVKWYGLKQPTHAIPRS
VIAPSGPSSESVEFYPPSFIFHLILPSSNLEELESEQQYDLNLIRQLPNLVIQKRFSIGN
SIGDLKRELTSNLLPAGLLTRSFKLWSIHSPPSNPNQLILSVSEFGNLETQLVEPSSGDA
ADLNEALLTDPVNVLAIEQQDQEGHWLINPKSAPPSTPPQLQDDDPTSSGPVFGGQEWLD
RMEKMNQANLLDPKFSITSPNSDLSLVAFNSAQSAFKARGIRGLVGLTNLGNTCFMNSAL
QCLSNCPELKTYFLSRVYINELNRTNPLGMGGKVAETFGQLIERMWSSEYEVSRRIQGST
SGTNGPTSYGGSSHQSISPREFKSIVGRFNSLFLGYGQQDSQELLTFLLDALHEDLNRVK
VKPFDEIPDYDDQNSLNDPLLEAQKILKLAKTCWNLYRRRNDSVIVDLFQGQYKSTLICP
DCNKVAIKFDEIMYLTLQLPINKKFRGTIYFVPLDLSKPRIKVNYQINKDSTIRQLKQHI
GQILCVDPDRMAAIEDWSGKPWKIWHDTDSLEGVMERDVINVFETPLPFAALKSGIYHTN
GEEEEVPDLLIPVVSYRPAERMNMGSSTSIHKPSSTAFGVFFVARISAKDRLSTRAVYDA
VAREYARYTSQAEELFERNEDEDVVMNEPTAEIPPSSSSQPTLHAVPNLFKISVPKTPCS
TVFPVSNAMGNATIELEERVKLSASKAPPGPAPVSGVNEDANGSNGAVFEMEENEDLYED
KAAAPEPRSSSSPSHSSQTGPVVFEGDYFECEWTPSAMGHFFGLDKNLPNSKNWIDPPVI
EDPELVASRVAEQNKKSGAAGELTIEECFKDFSKPEKLGSEDKWYCPRCKNHVQATKQMQ
IWKVPDILVVHFKRFSSARTSYGRSSKVDNFVDFPIQGLDLSNEVEGIKVVRELKKHQRN
LKASSRDQPVADQDQDHKNLPQILVDDHLPSSSNPSDHNNNDKVGGEGKEIDAILEDQNT
ELDDGKEERQQQQQQDGDRERDGHENPQQEGEDDEDEEEEESLIYDLFAVDNHFGGLGGG
HYTAFAKNEEDGKWHNYDDSHVTEVNSPERVKSSAAYLLFYRRRTTRKLGLKTHGIVSSA
MQSRDISARSSSQGNSSHMADDDEDGSRAAIKTGAGARHAAMASSSSNGLERPTSQEEEE
EVDELDEGVGAGVGAVGRGSSIGSVGREDGSLRSESPFSDLRPNLSRPISSSSSSPASHS
PDASHSASPASHSSSSELVPSLPLGHHSLLDSSDPILSHHSANHRDSSNLPAVGPSPADD
RHHVAPSAAPIPLPPVPPPPYKPHSSASSR
NT seq 4233 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggaggtcgagatggacgaaataccttcaccacaagaacaggctagactctat
cactcattcagatccatcagaatggcaaccgatcaaacctggtacctcatccatcaacaa
tggttcaacacctggtcatcctcaatcggaatagcaacagacgactcaacagcagcagga
acaacaacaacaacaacagacatcccatccatcgataactcagatttactcgatcatgag
aatcagctcagattcggcatctccatcggaatcgactgcgaaatcatccctgaagaattc
tggaacttgctcgtcaaatggtatggactcaaacaaccaacccatgcaatccctcgatcg
gtcatcgcacccagtggtccatccagcgaatcagtcgaattctatccacccagcttcatc
ttccacctcatactacccagctcaaacttagaagaacttgaatcagaacaacagtacgac
ctgaacctgatcaggcaattacccaatctggtcatccagaagagattctcgatcggaaac
tcgatcggggacctcaaacgagaattgacgagtaacctactcccagcaggtttgctcacc
aggtccttcaagctctggtcgatccacagtccaccctcgaatccaaaccaactcatcctg
agcgtgtccgagtttgggaacctggagacacagctcgtcgagccttcctcaggcgatgcc
gccgacctcaacgaagctctcctcaccgatcccgtcaacgtccttgccatcgaacagcaa
gaccaggagggtcattggctcatcaatcctaaatccgctcccccttcgactccccctcaa
cttcaggatgatgatcctacatcctccggtcccgtcttcggcggccaggagtggctcgat
cggatggaaaagatgaaccaggctaacctcttagaccccaagttctccatcacctctcct
aactccgatctcagtctcgtcgcattcaattctgcccaaagcgcgttcaaagctcgcgga
atcagaggcttggtaggactgactaatttgggtaatacatgctttatgaactccgcatta
caatgtttgagtaattgtccagaattgaagacctacttcttatcgagggtgtacatcaat
gaactcaataggacgaacccattagggatgggaggcaaagtagcggagacgtttgggcaa
ctgattgagcgaatgtggtcgagtgagtatgaagtgagtcgccggattcagggaagcacg
agcgggacgaacgggccgacgagttacgggggttcctcgcaccaatcgatctcaccacgc
gaatttaagtcgatcgtcggtcgattcaactccctcttcttgggatatgggcaacaagac
tcgcaagaacttcttaccttccttctggatgccttgcatgaagatcttaatcgggtcaag
gttaaaccgttcgacgaaatccccgattatgacgaccaaaactcgctcaatgatcccctc
cttgaggctcagaaaatccttaaactcgcaaagacttgttggaatctttatcgtagacga
aatgattccgttatcgtcgatctctttcagggtcaatataaatcgactcttatttgtccc
gattgcaataaggttgcaatcaaatttgatgaaattatgtatctcacattacaattaccg
atcaataaaaaattcagagggacgatttacttcgttccattagatttaagtaagcctcga
attaaagtgaattatcaaatcaacaaagattcgactatccgacaattaaaacaacatatc
ggtcagatcttatgtgtagaccctgatcgaatggctgctattgaagattggtcgggtaaa
ccatggaaaatttggcacgatacggattcattggagggagttatggaacgcgatgtgatc
aatgtatttgagactccactgccttttgcggccttgaagtcggggatctatcacacgaac
ggggaagaagaggaagtccctgatctattgatccccgtggtctcgtatcgtccggcggaa
cggatgaatatggggagcagtactagcatccacaagccatcgagcacggcctttggggtc
ttttttgtcgcccggatctcggcgaaggatcggctgagtactcgggcagtctacgatgcg
gtcgcacgggaatatgcccgatacaccagccaggccgaggagctcttcgaacgtaatgag
gacgaggacgtggtgatgaatgagcccaccgccgagattccgccctcctcctcctctcaa
cccacactccacgccgtacctaacctgttcaagatctccgtgcccaaaaccccctgttcg
acggtctttccggtctctaacgcaatgggaaacgcgacgatcgagctcgaggagcgcgtc
aagctctctgcctccaaagccccgcccggacccgcgcccgtgtccggtgtcaatgaagac
gcgaacggctcgaatggggcggtgttcgaaatggaggagaacgaggacctgtacgaagac
aaagcggctgcccctgaacctcgttcctcatcatccccctcccattcttcgcaaacgggc
ccggtagtcttcgagggagattacttcgaatgcgaatggacaccgagtgcgatgggccac
ttcttcggactagataagaatctgccgaactcgaagaactggatcgatccgccggtgatc
gaggatccggaattggtggcctctagagtagccgaacagaacaagaaatccggcgcggcg
ggggaattgacgatcgaggaatgttttaaggatttctcaaagccggagaagttgggctca
gaagataaatggtattgtcccagatgtaagaaccatgtccaagctactaaacagatgcag
atctggaaagtcccggacatcctcgtcgtccatttcaaacgcttcagctcggctagaacg
tcctatgggcgctcgtccaaagttgataactttgtcgactttcccatccaaggcttggat
ctttctaatgaagtcgaaggcattaaggtcgtccgtgaacttaagaaacatcaacgcaat
ctcaaagcttcttcgcgtgatcagccagttgctgatcaggatcaggatcataagaatctt
ccccagatcttggttgatgatcatcttccttcttcttctaatccctctgatcataataat
aatgataaggttggtggagaaggaaaagagatcgacgcgattctggaagaccaaaatact
gaacttgatgatggcaaggaggaacgtcagcagcagcagcagcaagatggagatcgggag
cgggacgggcatgagaatcctcagcaggagggggaggatgatgaggatgaggaagaagag
gaaagcttgatctatgatctctttgccgtcgataatcatttcgggggcttgggcggtggt
cattatactgcgtttgctaaaaatgaagaggatgggaaatggcataattacgatgattca
catgtgacggaagtgaattcaccagaaagagtgaaaagttcggcggcctatctgttgttt
tatcgccgaaggacgacgaggaagcttggtttaaagacgcacgggatcgtgagctcggcg
atgcaatcacgggacatctcggcgcgctcgtcgagccaagggaattcgagtcacatggcc
gacgacgacgaagacggctcaagagctgctatcaaaactggagcaggagcaagacatgca
gcgatggcgtcgtcgagctcgaatggcctggagagaccgactagccaagaagaagaagaa
gaagtcgatgaattggatgagggtgttggtgctggggttggggctgttgggaggggctcg
tcgatcggctcggtgggcagagaagacggctcgctcagatccgagtccccattctccgac
ctacgtcccaacctgtctagaccgatctcttcttcttcctcttccccggcttctcattca
cctgacgcttctcattctgcttctcccgcttcgcattcatcttcgtctgagctcgttccc
tcgcttccgcttggtcatcactccttgctcgattcttcggatcccatcctcagtcatcac
tcggccaaccatcgggactctagtaatctgcccgctgtcggcccatcgccggctgatgat
cgccatcatgtcgctccctccgccgctccgattcctctgccgcccgtcccccctccgcct
tataagccgcattcttctgcttcctctcgttga

DBGET integrated database retrieval system