KEGG   Puccinia graminis: PGTG_08623Help
Entry
PGTG_08623        CDS       T02226                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pgr  Puccinia graminis
Pathway
pgr00062  Fatty acid elongation
pgr00071  Fatty acid degradation
pgr00280  Valine, leucine and isoleucine degradation
pgr00310  Lysine degradation
pgr00380  Tryptophan metabolism
pgr00410  beta-Alanine metabolism
pgr00640  Propanoate metabolism
pgr00650  Butanoate metabolism
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
pgr01130  Biosynthesis of antibiotics
pgr01200  Carbon metabolism
pgr01212  Fatty acid metabolism
Module
pgr_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
pgr_M00085  Fatty acid biosynthesis, elongation, mitochondria
pgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PGTG_08623
   00650 Butanoate metabolism
    PGTG_08623
  Lipid metabolism
   00062 Fatty acid elongation
    PGTG_08623
   00071 Fatty acid degradation
    PGTG_08623
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGTG_08623
   00310 Lysine degradation
    PGTG_08623
   00380 Tryptophan metabolism
    PGTG_08623
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PGTG_08623
Enzymes [BR:pgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PGTG_08623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 10532114
NCBI-ProteinID: XP_003327856
UniProt: E3KGL2
AA seq 291 aa AA seqDB search
MMMMTIRRTASFLSPRSLTLARRFQSSQTPSYQNIIYSNPSPAVGLLTLNRPKALNALSS
PLFTEINDLLSSINSSSSSVKCLVLTGSEKSFAAGADITEMAERSLAEVYDADFLKFWSE
KISSFRVPIVAAVSGYALGGGCELAMMCDIILASKDAKFGQPEINLGVIPGAGGTQRLVK
AIGKSKAMEYILTGKTFSAQQAYEWGLISRVVDGGHEELLKESLALADTISTKPKLATKA
AKEAVNLAYELPLSQGLEFEKRLFHLLFGTNDQKEGMKAFVEKRKPKFTHS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgaccatccgacgaaccgcttcatttttgtctcctcgttcactcaccctt
gccagacgcttccaatctagtcaaaccccgagctaccagaacataatctattcaaaccca
tcacccgcagttggtctcttgactctcaaccgaccgaaagcactcaacgcactctcgtcg
cctttgttcactgaaatcaacgatctcttgagctcgatcaactcctcctcctcttcggtt
aaatgtctcgtcctcaccggatctgaaaaatcgtttgcagccggggccgacatcaccgag
atggctgagcgctccttggccgaggtttatgatgctgacttcctcaagttctggtcggag
aaaatcagctcatttagggtcccgatcgttgctgccgtgagtggttatgcgctcggtggg
ggttgtgaactggcgatgatgtgtgatataattttagcttcaaaagacgccaagttcggt
caaccagagattaatttaggtgtgatccctggagcaggaggaactcaaagactggttaag
gcgattgggaaatcaaaagcgatggaatacattctcaccgggaaaacctttagcgcccaa
caagcttatgagtggggtttaatatctagagtcgttgatgggggtcatgaagaattgctc
aaagagtctctagctttggcagatacaatctcaaccaaaccaaaattggccaccaaggca
gcaaaagaagctgtcaatttagcgtatgaattgcctttgagccagggattggaatttgag
aaaagattattccatttgttgtttggcacaaatgatcaaaaagagggcatgaaagcattt
gttgaaaaacgtaaacccaagttcacacactcttag

DBGET integrated database retrieval system