KEGG   Puccinia graminis: PGTG_08623Help
Entry
PGTG_08623        CDS       T02226                                 

Definition
enoyl-CoA hydratase
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pgr  Puccinia graminis
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGTG_08623
   01212 Fatty acid metabolism
    PGTG_08623
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PGTG_08623
   00650 Butanoate metabolism
    PGTG_08623
  Lipid metabolism
   00062 Fatty acid elongation
    PGTG_08623
   00071 Fatty acid degradation
    PGTG_08623
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGTG_08623
   00310 Lysine degradation
    PGTG_08623
   00380 Tryptophan metabolism
    PGTG_08623
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PGTG_08623
Enzymes [BR:pgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PGTG_08623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 291 aa AA seqDB search
MMMMTIRRTASFLSPRSLTLARRFQSSQTPSYQNIIYSNPSPAVGLLTLNRPKALNALSS
PLFTEINDLLSSINSSSSSVKCLVLTGSEKSFAAGADITEMAERSLAEVYDADFLKFWSE
KISSFRVPIVAAVSGYALGGGCELAMMCDIILASKDAKFGQPEINLGVIPGAGGTQRLVK
AIGKSKAMEYILTGKTFSAQQAYEWGLISRVVDGGHEELLKESLALADTISTKPKLATKA
AKEAVNLAYELPLSQGLEFEKRLFHLLFGTNDQKEGMKAFVEKRKPKFTHS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgaccatccgacgaaccgcttcatttttgtctcctcgttcactcaccctt
gccagacgcttccaatctagtcaaaccccgagctaccagaacataatctattcaaaccca
tcacccgcagttggtctcttgactctcaaccgaccgaaagcactcaacgcactctcgtcg
cctttgttcactgaaatcaacgatctcttgagctcgatcaactcctcctcctcttcggtt
aaatgtctcgtcctcaccggatctgaaaaatcgtttgcagccggggccgacatcaccgag
atggctgagcgctccttggccgaggtttatgatgctgacttcctcaagttctggtcggag
aaaatcagctcatttagggtcccgatcgttgctgccgtgagtggttatgcgctcggtggg
ggttgtgaactggcgatgatgtgtgatataattttagcttcaaaagacgccaagttcggt
caaccagagattaatttaggtgtgatccctggagcaggaggaactcaaagactggttaag
gcgattgggaaatcaaaagcgatggaatacattctcaccgggaaaacctttagcgcccaa
caagcttatgagtggggtttaatatctagagtcgttgatgggggtcatgaagaattgctc
aaagagtctctagctttggcagatacaatctcaaccaaaccaaaattggccaccaaggca
gcaaaagaagctgtcaatttagcgtatgaattgcctttgagccagggattggaatttgag
aaaagattattccatttgttgtttggcacaaatgatcaaaaagagggcatgaaagcattt
gttgaaaaacgtaaacccaagttcacacactcttag

DBGET integrated database retrieval system