KEGG   Puccinia graminis: PGTG_08711Help
Entry
PGTG_08711        CDS       T02226                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pgr  Puccinia graminis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PGTG_08711
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PGTG_08711
Transfer RNA biogenesis [BR:pgr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PGTG_08711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 427 aa AA seqDB search
MPAAFQIQRIGISSSRLFGCSRTLHSKPIPQLLDQRNSTKAMVIPIQSGYQLEREVAVAA
VLQASLVTRRIFDKLIRPGLQTGDNNQASITKVDRSPVTVGDYTVQALLNFILSKYFPDD
EIVGEEDSSELLKTTDKKHLQQIIDFTNEGLKEDRLSIPTDEEKWSKFRSQPALTEDELV
KLIDLGKSAGGKPGENRRFWTLDPIDGTKGFLRGGQYAICLALIVDGEAVLGVIGTPNLP
LKGIPSPTDTEPTGVLFLAEKGSGAFQRALGVDEYTEIKMKPHERGSLGREGTFCESFDA
GHSNQLVTGDIARKLNMLNAQSPIRIDSQAKYCVLARGDSDVYLRFPTQADYQEKIWDHA
AGSIIISEAGGKVVDLDGKPLDFSGGRTLSNNHPGFLACHNQVLVDVLKAAKAAHENQLK
QQKLHKY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccggcagctttccagattcaaagaatcggaatatcatcgagtcgactatttggatgc
agtaggacccttcattcaaaaccgatacctcaactgctcgatcaacgaaactcaaccaag
gcgatggtgattccaatccaatcgggatatcaattagaacgggaggttgcagtcgcggcc
gtcttacaggcctccctcgtcacccgaaggatatttgataagctgattcggccgggcctg
caaactggggacaacaatcaagcctcgatcactaaagtcgatcgtagtcctgttaccgtt
ggagactacactgttcaagcgttgctcaattttatactctcgaagtacttcccagacgac
gagattgtaggagaagaagattcatcggaattgttgaagacaacagacaagaaacactta
cagcagatcatcgacttcacgaatgaaggtttgaaggaagatcgattgagtataccaacg
gatgaagagaaatggtcgaaatttcgatctcaaccggcgttgactgaagacgagttggtg
aaattaattgacttgggcaaaagtgcagggggtaaaccgggcgagaatcgacggttttgg
acgctcgatccgatcgatggcaccaaaggattcctacgcggtggacaatatgcgatctgt
cttgccttgatcgtcgatggagaagcggtactcggggtcatcggaacgcccaacctacca
ctcaaaggtataccaagtccaaccgacactgaacctactggtgtgttattcttagccgaa
aagggctcgggagctttccaacgagccttaggagtggatgaatataccgagatcaaaatg
aaaccgcatgagcgagggtccctgggtcgagaggggacgttttgtgaatcgtttgatgcg
ggtcactctaaccaactcgtcaccggtgatatcgcacgaaagctcaacatgctaaatgct
caaagcccaatcagaatcgatagtcaagccaagtattgtgttctcgcgagaggtgatagt
gatgtttatctacgatttcctactcaagctgactatcaggaaaagatttgggatcatgct
gcaggaagcatcataatcagtgaagcaggcggcaaggtcgtcgacctggacgggaaacct
ttggatttctctggtggtcgaacactgtccaataaccatccaggcttcttggcttgccat
aatcaagtgctggttgacgttttaaaggctgcaaaggcagcacacgaaaatcaattgaaa
caacaaaaattacacaagtattaa

DBGET integrated database retrieval system