KEGG   Puccinia graminis: PGTG_09014Help
Entry
PGTG_09014        CDS       T02226                                 

Definition
NADPH-ferrihemoprotein reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PGTG_09014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 756 aa AA seqDB search
MLSLSSTDLILLSVIGALTLYWLYARLFANPSSSTVHRTNPTHQQQLQGFNIHNGPRSDS
NPELLAAGRDFVKKMDLQKKKAVVFYGSQTGTAEDYATRIAKEAKSKFGISSLVADPDEY
DFDCLEKLRADQLAIFVLATYGEGEPTDNAVNMLEQLKEQQTEGNQLDHLNYVVFALGNR
TYEQFCQMGIIVDELLTKRGAKRIGELGMGDDDKSMEEDYLAWKDPMWEQVQKVMGWEEG
AGGDEPDFLVKEVEVNPGKEGSIDDGQVYRGELSGRALMGTRGIFDAKNPCPARVANARE
LFAAGDRNCVHMEFEIQGTGIRYQTGDHLAVWPVNPDSEVARLMKLLGLWEKRATAVEIS
SLDPMLAKVPFPTPASYEAIFRHYLDISCIASRQLLSGLARFAPTEAASAALKAIGTDKE
HYQRVVAGPGLRLGECLMSVLPGGAEKLSVEDPLSESFGQGWFQTYQIPFDQIISGLPRL
QPRFYSISSSPKMYPDQIHITAVVLKYPSGSRMIYGCGTNYILNAKMFLHGEKERMEHQP
IDQRSSGAPHYTLSGPRGKYLEDGTKLKIPIHVRRSNFRLPTSPKIPVIMIGPGTGVAPF
RAFVQERMMLARKAKAKAKEANGLQGEADALNDWAEIMLFYGCRKEEEDFLYKNEWPEYA
EEFNGKFKMFTAISRRPELGGKKEYVQDLIKLQTERIYKMIIEQKGYIFICGDGKSMVKC
VEESLKTIFESTGTKNGAAELKFLKDRNRLLLDVWS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgctctcactctcatccaccgacctcatccttctctcagtcataggagcactcaccctc
tactggctatacgcaagactcttcgccaacccatcatcctcaaccgtccaccgaacaaac
ccaacccatcaacaacagctccaaggattcaacatccacaatggcccccgatccgactcc
aaccctgaactactggctgccggcagagattttgtgaagaagatggatttacagaaaaag
aaagcggtggtcttttacggttcccaaactggcacagccgaagattatgcgacccggatc
gccaaagaggccaaatcgaaatttggcatctccagtctcgttgccgatccagacgagtac
gattttgactgtctcgaaaagctgagagctgaccagctagcgatctttgttctggcgacc
tatggcgaaggagagccaaccgataatgcagtcaacatgctcgaacaactcaaagaacaa
cagactgaaggaaaccaactagaccatctcaactatgtcgtcttcgctctcggaaatcgc
acctatgaacaattctgtcaaatgggaatcatcgttgatgagctgttaaccaaacgtgga
gctaagagaatcggagagctggggatgggcgatgatgataaatctatggaagaagactat
ctggcctggaaagacccaatgtgggagcaagtccagaaagtgatgggatgggaagaaggt
gcaggaggagacgaacccgactttctggtcaaagaagttgaagtcaacccaggtaaagag
ggatcaatagatgacggtcaagtttatcggggtgaactaagtggaagagcattgatgggt
actcggggtatctttgacgccaagaacccctgtcctgccagagtagccaatgcccgagaa
ctgtttgcggccggggaccggaactgtgtccacatggagtttgaaattcaaggcactgga
attagataccaaacgggtgaccatctagccgtatggcccgtgaacccagattctgaagtc
gccaggttaatgaaattacttggactgtgggagaagcgagccacagcagtagagatttcc
tcgctagaccccatgttggccaaagtgccgttcccgacaccagcatcgtatgaggctatc
ttccggcattatcttgacatttcatgcattgcatctcgtcagctgctgtcaggactagcc
aggtttgcgcccacagaagcagctagtgcggcgttgaaagctatcgggaccgacaaggag
cattatcagcgtgttgtcgccgggcccggtctgagattaggagagtgcttgatgagcgtc
ctgcctggtggagctgagaagttgtcggttgaagacccactgtctgagagcttcggtcaa
ggctggtttcagacttaccagatcccattcgatcagatcatcagcggtctgccccgtctt
cagccaaggttctactcgatctcttccagtccaaagatgtatcccgatcaaatccatata
accgctgtcgtgcttaaatacccttcaggaagccggatgatttatggctgtggaacaaac
tatattttaaacgccaagatgtttttacacggggagaaggagcggatggaacaccaaccg
attgaccagcgttcaagcggagccccgcattataccttatctggcccgcgaggcaaatac
ctagaagacggcacgaagttgaagatcccgatccacgtccgacgatcgaacttcagactg
cctacgtcgccgaagattcccgtgatcatgatcggtccagggacgggagtggcgccgttc
cgagcgttcgtccaggaacgaatgatgttggctcgcaaagcaaaagctaaagccaaggaa
gccaatggtctgcaaggcgaggctgatgccctcaacgattgggcagagatcatgctgttc
tacgggtgcaggaaggaagaggaagatttcttgtataagaacgagtggcctgaatatgca
gaagaattcaacggcaagttcaagatgtttacggcgatctcaaggagaccagaactagga
gggaagaaagaatacgtccaggacttgatcaagttacaaaccgagaggatatacaagatg
attatcgagcagaaggggtatatctttatctgtggagatgggaagagcatggtcaaatgt
gtcgaagaaagcttgaagacgatcttcgaatcgaccgggaccaagaacggggcggctgaa
ctgaagttcttgaaagaccggaatcgtctgcttttggatgtgtggtcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system