KEGG   Puccinia graminis: PGTG_09117Help
Entry
PGTG_09117        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
pgr  Puccinia graminis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pgr00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 645 aa AA seqDB search
MCPLQGKLSNYSPQHSLAAGATRLSRVSSVSFFFTLHHRPSNMAFRLSTLILVGLFVCLS
NVSAASARPETGSPNLRRRDPALAKSPSGNYAPTYIQCPQDPFVRAPNDKQNQQTRLGKG
ESDYIKDKAAQSIPLWQKYLENVKLENFNIDDFLKSAKQSGGVAALTLPNIGLALSGGGM
RALCFSGSILDSFDSRNQKANEAKVGGILQLANYAVGVSGASWLLGSWATSNFPQIQTLV
PNWRLSEDNSLWDWNIAKDYWSHYKTVQEKRKAGFPVSIVDAWGRILSRHFINEPDKKNS
QKGKEVLWSSIRETSGYKRRDVPFVMAVTTSRPDKGEPFTPESPTYEFSAEEFGIFNPYL
NASIPIEHLGSTHTAGNPDPQGCVAGFDNAGFVMGMSSNIFSRGDSPRHEKRPKYLTAVR
TFINDINFEGKIPNAFKGLGKTSAFQSARYQDTDRDLILMADSGLIHENIPLFPLIQPER
KLDVIIALDASADGSDEDDPNLYTYPNGTHMYSIYTKTKLPPYKGYHMPSIPNALDGTFT
KLGYNKRPTFFGCEDRQGPLIVYLPNYYATGKTNTVTTKISYKPEEIDEFFFNGFALATQ
SMGPTQNKDWPMCLACALVDRQVLRNSAVRSAQCQACFKAYCDAP
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccccttcaaggaaaactctccaactattctcctcaacattcattagccgccggt
gctacacggctttcaagagtctcatcagtgtctttcttttttactttacatcacagacct
tcaaacatggcctttcggctgtccactctaatcctggtgggactgttcgtctgcctcagc
aatgtgtcggcagcgtccgcccggcccgaaaccggcagtccaaacttaaggcgaagagat
cctgctttggccaagtcaccttctggaaactatgctcccacatacattcagtgcccgcaa
gatcctttcgtccgggctccgaacgataagcaaaatcagcagaccagactcggaaaagga
gagtccgattacatcaaagacaaagctgcgcaatcgattcccttgtggcaaaagtatttg
gagaacgtcaaactggaaaatttcaacatcgatgatttcctgaagtcagccaaacagagt
ggaggtgtggccgcgctcactctgcctaacattggtctagccctcagcggtggtggtatg
cgtgcgctgtgcttcagtggatcgattctggactcattcgactcgaggaaccagaaagcc
aatgaggccaaagtcggcggcattcttcaattagctaattatgccgttggtgtatcaggt
gcaagttggttattgggatcgtgggctacctccaacttccctcaaatacaaactcttgtt
ccgaattggcggctatcagaggacaactctttgtgggattggaacatcgcaaaagattat
tggtcccattataaaacggtgcaggaaaaacgcaaagctgggttccccgtcagtattgtt
gatgcatggggcagaattctttctcgtcactttataaatgagcccgacaaaaagaactca
cagaaaggaaaagaagtcctttggtcatcgatccgggaaacgtcgggctacaaaagacgt
gatgtaccttttgtgatggctgtgactaccagtcggccagacaagggggaaccattcacc
ccggaaagtccaacatatgagttctccgccgaggagttcggtatcttcaatccttatctc
aacgcatcaatacccattgagcatcttggatccacccatactgctggcaaccctgatccc
caaggctgtgttgctggctttgacaatgcgggatttgtgatgggaatgtccagcaacatc
ttctctcgtggggattccccaagacacgaaaaaaggcccaaatatttgacggcggtccgc
acattcatcaacgacataaattttgaaggcaaaatacccaatgcctttaagggtctagga
aagacgtctgcgtttcaaagtgcacgataccaggacacagacagggacttgattttgatg
gcagattccggattgattcacgagaacatccccttgtttcctttgattcaaccggagcgc
aaactcgatgtgatcattgcgttagatgccagtgccgatgggagcgacgaagatgaccca
aacctgtatacatatcccaatggtactcacatgtatagtatctacactaagaccaagcta
cctccttacaagggctatcacatgccaagcattcccaatgcccttgacggtaccttcacg
aagctaggatacaacaagcgacccacgttcttcggctgtgaagaccgccaaggccccctt
atagtctaccttcctaattattacgctactggcaaaacaaacacagtcactacgaaaata
tcctacaaaccggaagagattgatgaattctttttcaatggattcgcattggccacccaa
agcatgggcccaacccagaacaaagactggccgatgtgtttggcgtgcgcattagtcgac
cgacaagttctccgaaactccgccgtccgaagcgcccaatgtcaagcctgcttcaaagcc
tattgcgacgctccttga

DBGET integrated database retrieval system