KEGG   Puccinia graminis: PGTG_09193Help
Entry
PGTG_09193        CDS       T02226                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pgr  Puccinia graminis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGTG_09193
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGTG_09193
   00630 Glyoxylate and dicarboxylate metabolism
    PGTG_09193
Enzymes [BR:pgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PGTG_09193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 240 aa AA seqDB search
MTVPFMDAYVRLLIKTCHSRGVAAMGGMSAQIPIKDNPKANEAAINKVKADKLREVKAGH
DGTWVAHPALVKVALDIFNENMVGPNQYHVRRSEVQVTALDLLNTNVPGKITEHGIRENI
SAALQYCANWITGVGCVPIANLMEDAATAEIARLQIWQWVRHGSMTDAHKKITAEWIDQI
LEEETAQAKKTTAKGLNPAKVDIAQRYLSSQAHAPVPDDFLTSALMTSLDDMAAPNRPKL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccgttcatggacgcctatgttcgtctcctgatcaaaacttgtcattccaga
ggcgttgctgccatgggaggaatgagtgcgcagattcccatcaaagacaatcctaaagca
aacgaagcggctatcaacaaagtcaaggcggacaaattgagagaggttaaggctgggcac
gatggaacatgggtcgctcatcctgctttggtgaaagtagcccttgacattttcaatgaa
aacatggttggacccaaccaatatcacgtgcgtcgctcagaagtgcaagtgactgccctc
gatttactcaacacgaatgtacccggaaaaatcaccgagcacggtatccgcgagaacata
tctgccgccttacaatactgtgccaattggatcactggggttggttgtgtgccgattgcg
aatctgatggaagacgctgctactgcagaaatagcgcgtcttcaaatatggcagtgggtt
cgacatggttctatgaccgatgcccacaaaaaaatcactgccgagtggatcgatcaaatc
ttggaggaagaaactgctcaagccaagaagacgaccgccaagggattaaatccagccaaa
gtcgatatagcacagcgctatttgagttcgcaagcgcatgcaccagttcctgatgatttt
ctgactagtgcgctcatgaccagtttggatgatatggctgccccaaaccgaccaaaactg
taa

DBGET integrated database retrieval system