KEGG   Puccinia graminis: PGTG_09319Help
Entry
PGTG_09319        CDS       T02226                                 

Definition
L-asparaginase
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PGTG_09319
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     PGTG_09319
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     PGTG_09319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 652 aa AA seqDB search
MMKHHSQIRDANESRVLVLYTGGTIGMLSGPKGYSPLPGYLSEHLRSQPRFHDPSSSSLC
TNSQTVDAFRSWQSLVSLNSPSSSSTSPIYPPANNPPSPASAEAGPTTDETSRFNGNQLK
VITENGSQWLDSLVMQESHGCPKIRYAILEYERLIDSSEIEISDYLRICNSIQSNYYLYD
SFVILHGTDTMAYTASALSFLLENLGKNVIITGAQIPLSCPRNDAVENLLGALQISGTYL
IPEVSLYFNHRLWRGNRSMKVSSVEFDAFKSFNLEPLVKLGCNVEVRWDLIYRPVERQAF
RVHQAMCENVAVLRLFPSITPASVRAFLAPPIQGIVLETFGSGNAPRKPALLQAFKEAAD
RGVVIVNVTQCVVGTVSSDIYETGRALAAVGITGGRDMTTECALAKLAYLLSKPSLSPAK
IRTLISQPLRGELTLPARVQFQPQPVEDRLNWLMKHITSLQLDNRDPPLSDGRKEEIGNL
NIRESLPQIPATIISDDSAPLLQRSSTHLGRLAVYQDVGVELETSEMLQKEQDLTERSLL
PIALTAASARDDSSLASLLAICSDQIQTQGLLNLRTATGLGQTALHLAAFYGRLKNVELL
LDHGASVHLRDDTGHTALFYAINNQHKACVDLLVKAGAHLTNFEQDEDCSSS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcatcacagccaaattcgagatgccaatgaatcacgcgtcttggtgctctat
accggcggtacgattggaatgctgtccggaccgaagggttattccccacttcctggatac
ttatcagaacacctacgctcccagccccgatttcacgatcccagctcgagttccttatgt
accaacagtcaaaccgtggacgcctttcgatcatggcaatcactagtatcgctcaattcc
ccgtcctcatcctcaaccagtccaatctaccctcccgccaacaacccgccttccccagcg
agcgccgaagctggacccactacggacgaaactagcaggttcaatggcaaccaattgaaa
gtcatcaccgaaaatggctcgcaatggttagatagcttggtcatgcaagagagtcatgga
tgtcctaaaattcgctatgcgattcttgaatatgaaagactgattgattcatctgaaatc
gaaatctcagattacttgaggatctgcaattcgatccaatccaattattatctatatgac
agctttgtgattttacacgggacagatacgatggcatatacggcctcggcactctccttc
ttgctcgagaacttgggcaagaacgtgatcatcaccggcgctcaaatcccactctcatgt
ccccggaacgatgctgtggaaaacctgctgggggctttgcaaatctcaggcacgtatttg
atacccgaagtctccttatattttaaccatcgtctctggaggggaaaccggtcgatgaaa
gtcagcagtgtcgaattcgatgctttcaagagcttcaacctcgaaccgttggtcaaactc
gggtgcaatgtcgaggtcagatgggatctcatttacaggcccgtcgaacgacaagctttc
agagtccatcaagccatgtgcgagaacgtcgccgtccttcgtctctttccgagtatcaca
cccgcctccgttcgtgcctttctggccccaccgatacaagggatagttctagaaaccttc
gggtccggcaacgcgcctcgcaagccagcactgcttcaagcctttaaagaagccgctgac
cgtggggtggtcattgtcaatgtgacgcaatgtgttgttgggacggtgtctagcgatatt
tatgagactgggcgggccttagctgcagtgggaatcactggcggtcgtgatatgaccaca
gagtgtgcacttgctaaactggcttatcttctatccaagccatccttgtcgccagccaaa
atccgtaccctgatcagtcagcctcttcggggagagcttaccctgcccgcacgcgtgcag
tttcagcctcagccagttgaggatcggttgaattggctgatgaagcatatcacttcttta
caattggacaaccgtgatcctcctctctccgatggtcgcaaggaggaaattgggaacttg
aacatcagggaaagccttccacaaattccagcaaccatcatttcagatgattccgctccg
ctccttcaacggtcatccactcaccttggaaggctcgcagtttaccaagacgttggagta
gagcttgaaacgagtgagatgttacaaaaggagcaagacctgaccgaacggtcgttgcta
ccgatagccctgacggcagcctccgcgcgcgatgattccagtctcgcttcgttactagcg
atctgctcggaccagatccaaacccaagggcttctcaacctccgtacggccaccggcttg
ggccagaccgctctgcatctggcggccttctatggacgcttgaagaacgtcgagttgctc
ctcgaccatggggcttcggttcatctcagagatgacactggccataccgcgctcttctat
gctatcaataaccagcataaggcgtgtgtcgacttgctggtcaaagctggggctcatctg
accaactttgaacaggacgaggattgctccagttcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system