KEGG   Puccinia graminis: PGTG_09875Help
Entry
PGTG_09875        CDS       T02226                                 

Definition
histone-lysine N-methyltransferase SETD2
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pgr  Puccinia graminis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PGTG_09875
Enzymes [BR:pgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PGTG_09875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 974 aa AA seqDB search
MEIEEEKTKEKETKNYEEEEEGPSRNQENKKILVEEEHQQQQQITILSQTPESQHSTSST
SITPITPAEELVSCLPSASSSALKTSSNKPRKSKGKEKDGVPEHVQLISDLPQANHQALE
TFTQIDQNWYQNKSLGTTKQLEDAMVCDCTWTPGDDPSWACSEHSGCINYLTQIECLQDQ
CRCREKCQNQRFQKRLYAPIEIVLTPKKGFGMRLQADVPKDTFVYEYLGEVIGVKALHKR
LKDYGQEGIKHFYFMELQKDQYIDATKKGGFGRFLNHSCNPNCYIGKWVVGRQLRMGIFT
KRAVRGGEELTFNYNVDRYGHEAQECFCGEANCVGFLGGKTQTDLGAMDELYIDALGIVD
DVENLNLKGSKTKKSKSMDIDYMPVMKPIPLKDVPKVAAAIRQSTSNRKILSKLLRRIMI
TTDQAVQKQLMRLHGFSLMSMILNEYLSDQEIVQTILEILLKWPLITKNKIVSTNIEETV
MKLSDNPSEVIQTLAAEVIKMWVALEVSYRIPKDKKNGEVADGSKRKAEALLDQIFSKRL
RDSNARKDIGGLKLVSEKAFIRPEAAKRIDPQTIKPENLTLPPDWAFERTAEGRPYYYHV
AIRETQWTVPTAADVALMDRRLAEQIARQKAAAANVEDIVAKAKAEAEEIRKASEAQRAS
EEAEKARLKSLHSDRKDKLRPSRSSSSHHHNHHHHHHHHRKKNSKELPSGGSAKASSSDL
KNEINNPAKDKKMLRLFSNVVVHTMSRYKDSLDHEQFKRRAKELTNILCEKERKSTHYQS
EMYEEMSAAKEMKIKAFTKDWMVKLLTRKGIEIPPPSSTGTTTTTMASTSTGKKPMTMLE
EGGHRRAEDRALGSSTADYQDYKAADDRPSEAREPDRHPIPSSSSNPSSCQSDPDSRPHP
RTQNRSRHRSRSRSRSRSRSRSRSRSRSRTGSHRNQDRTFRPPNSSPQRDRNPLQDPARA
GRAAKPSRRSPSPL
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgaggaggagaagacgaaggagaaggagacgaagaactacgaggaggaagaa
gaaggaccatcgaggaaccaagagaacaagaagatcctggtcgaagaggaacaccaacaa
caacaacagatcaccatcctctctcagacccccgaatcacaacactccacctcaagcaca
tcgatcactcctatcacgcctgccgaagagctcgtcagctgcctgccttccgcatcgtct
tcggctctcaaaacaagtagcaacaagccacgaaaatcgaaagggaaggagaaggatggg
gtcccagaacacgtccaattgatctccgacctcccgcaagctaatcatcaagccttggaa
acgttcactcagatcgaccagaattggtaccaaaataagtccctagggaccaccaaacaa
ctcgaagatgcgatggtctgtgactgcacatggacccctggcgacgatccgagttgggcg
tgtagcgaacacagcggatgcatcaattacttgacccagatcgagtgtcttcaagaccaa
tgtcgatgtcgcgagaaatgccaaaaccaacggtttcaaaagcggctttatgcgccgatc
gagatcgttctgacccccaagaaagggttcggaatgcggctccaagccgatgttccaaag
gacacgttcgtgtatgagtatctgggcgaagtgatcggggtgaaagcgctacacaagaga
ctaaaagattacggccaagaagggatcaagcatttctacttcatggagctacagaaagac
caatatatagatgcgaccaagaaaggcgggttcggcagattcctcaatcactcgtgtaat
cccaactgttatattgggaaatgggtcgtggggcggcagttgaggatgggcatcttcacc
aaacgggccgtcaggggcggcgaagaactcacgtttaattacaacgtcgatcgttatggt
catgaggcgcaagaatgtttctgtggtgaagctaattgcgtcggcttcctgggcgggaaa
actcagactgatctaggagcaatggatgaactatacatcgatgctttggggattgtggat
gatgtggagaacttgaacttgaaaggtagtaagacgaagaagtctaagagcatggacatt
gattacatgccggtaatgaaacctatcccgctcaaagatgtgcctaaagtggctgcagcc
atccgacaatcaacctctaatcgaaagatactatcgaaactacttcggagaataatgatc
acgacggatcaggctgttcagaaacagttgatgagattacatgggtttagtttgatgagt
atgatcttgaacgagtatctatctgaccaagagattgttcaaacgattttagagattttg
ttgaaatggcctttgatcactaagaataaaatcgtgtcgactaatatcgaagagactgtt
atgaagctctcggataatccttctgaagtcattcagactttggctgctgaggtaattaaa
atgtgggtggctttagaagtttcgtatcggattccgaaggataaaaaaaatggagaggta
gcggatggtagtaaacgtaaagcggaggcactattagaccaaatattctcaaaacgattg
cgagatagtaatgctcggaaggatattggtggcttgaagctagtatccgagaaagcgttc
atcagaccggaagcggcgaagcgtatagacccgcagacgatcaagcccgagaatctgacg
cttccgccggattgggcgttcgagcggacggcggaaggcaggccgtactactaccatgtg
gccatccgagagacccaatggaccgtgcccacggccgcagacgtggccctgatggatcgg
cgactggccgaacaaatcgctaggcagaaggccgccgccgctaacgtcgaagatatcgtc
gcgaaagctaaggctgaggctgaggaaattcgcaaagctagcgaggctcaacgggcgtct
gaggaggccgaaaaggctagactgaaatccctgcactccgatcgtaaagataaactccgc
ccttctcgatcttcctcctctcatcatcataatcatcatcatcatcatcatcatcatagg
aaaaaaaattcaaaggaactcccctctggggggtctgcaaaagcctcctccagtgacttg
aaaaacgagatcaataaccccgccaaagataagaaaatgctcaggttgttcagtaacgtc
gtcgttcatactatgtcaagatataaagactctttagatcacgagcaattcaaacgacgt
gctaaagaattaacgaacatcttgtgtgagaaggaacggaagtcgactcattatcagagc
gagatgtatgaagaaatgagtgcagcaaaggagatgaagatcaaagcatttacgaaggat
tggatggtcaagttattaacaagaaaaggcatcgagatcccgccaccatcatcgacagga
acaacaacaacaactatggcatcaacatcgacagggaagaagccgatgacgatgttagaa
gaggggggtcatcgaagagcggaggaccgggcgttgggatcatcgacggccgattatcag
gactacaaagcggccgatgaccggccctctgaggctcgtgagccagatcgacatccaatc
ccttcgtcatcaagtaatcctagtagttgtcagagcgatccagactcaagacctcatcct
cggactcagaatcggagtcgacatcggagccggagtcggagtcgaagtcgaagtcggagt
cggagtcgaagtcgaagtcgaagtagaactggttcccatcggaatcaggatcgcaccttt
cgtcctccaaactctagtccgcaacgggatcgcaaccctctccaagatcccgctcgtgcc
ggtagagccgccaagccttcgagaagatctccgtcgcctctctga

DBGET integrated database retrieval system