KEGG   Puccinia graminis: PGTG_09883Help
Entry
PGTG_09883        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
pgr  Puccinia graminis
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pgr04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 731 aa AA seqDB search
MAHKQHDDHRSSPPRSIEELSGIAQVPFDARLAIKSYVRSCEMLYQQAKKDEEQLELAYI
YLSRAARIIIHDLPSHPDYHQLPPSYQAQLKADGLKYLEALLPIKSKLKHQHQLYQQQHS
FSPSQSSSLSNTPPQPHQHPKQKSSISDWTLIDSPELSYEPLLPKQQQQHCSPHKKLHKN
HHLSSPITRRSSSSKSSPSTCSDSSTSVLPSAAINNHRIVNPLVWPVELGNGLGRPMTVA
LPHHNRPSSHRNHHQLSVDLPDSSPPTREHPHSSKKNPLASSQPISSRSFRHLGLYELQD
PPSPSHQPSPPSLNRSATQKEQAQDSLKAKKQRASWADRRPLPASATTTDPQEPSQSLAR
SFRSLLRPRRLSWSSASPTAITKPRRAPSVESWASVQIPSPPPPPPPVGLESPAHILTPL
QQQQQQQQQQTRSRSRRGSLGEPASWRWLKALKSSPDPSSPSASQQPPSNGPLYTHFPAL
ISPELHPSRPRLPSLPSPSPSSSSTAPPIHHHHHHHHHHRKAQRETKRRKLLLCPAQLVG
AFVAMAEPQTAQGIELCGLLLGSTIGDRLVVNTLLIPRQISTANSCHTVDEAQTFEVQSR
AGLLTLGWIHTHPTQTCFLSSVDLHTHLSYHLMLPESVAIVCSPNKHPSVGVFKLVEPSG
VDFLRQCPNNLDAFHPHDMADNLLYTTPARNEFVFVEPGGQQADDDDVGDDGGGGGSVGL
DFEIIDLRGPE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggctcacaagcagcacgacgaccatcgatcatccccgccacggtcgatcgaagagctc
agtgggatcgcccaggttccgttcgacgctcgtctggcgatcaagtcctacgtccggagc
tgtgagatgctataccagcaggctaagaaggatgaggagcagctcgaactggcttacatc
tacctctccagagcagccaggatcatcatccatgacttgcccagccatcccgactaccac
caactaccacccagctatcaggctcaactcaaagcagatggactcaaatacctcgaagca
ctcctgcccatcaaatccaaactcaaacaccaacaccaactgtaccaacaacaacactca
ttcagcccatcccaatcttcctccctctccaacacacccccacaaccccatcaacacccc
aaacagaaatcatccatctccgactggaccctcatcgactcccccgaactaagctacgaa
ccactactcccgaaacaacaacaacaacactgctctccacataaaaaactccacaagaac
caccatctctcatcccccatcacccggcgctcctcttcctctaaatcatcaccctccacc
tgctccgactcgtccaccagcgtcttgccttctgctgcaatcaacaaccatcggatcgtc
aaccctttggtctggcccgtcgagctcggaaacgggctcgggaggcccatgaccgtcgca
ctccctcatcacaacagaccctctagtcacaggaatcatcaccagctctccgtcgatctc
cctgactcctctcctccgactcgagaacatcctcattcctccaagaaaaacccactcgca
tcgagccagccgatcagctccaggagcttccgtcatctcggcctctacgagctccaagac
cctcccagcccatctcaccaaccttctcctccgtctctcaatcgctctgcaactcaaaaa
gaacaagcccaggacagtttgaaagccaagaaacagagggccagttgggccgaccgacgt
ccactccctgcttctgccaccaccaccgaccctcaagaaccctcgcagagcttggcccgc
tcgtttcgcagtctgttgagaccccgaagactctcctggtcctccgcctcccccaccgcg
atcaccaagccccgtcgagctccctcggtcgagtcctgggcatccgtccagatcccctcg
cctcctcctcctcctcctcctgttggtttggagtccccggctcatatccttactcccctc
caacaacaacaacaacaacaacaacaacagactcggtctcggtctcgaagaggatcgctc
ggcgaaccggcgtcttggcgatggctgaaagccctcaaatcctcccccgatccttcttcc
ccttctgcttctcaacaaccgccgtccaatggcccgttatacacccacttcccagcccta
atatctcccgagcttcatccctctcgacccagactcccctccttaccttctccgtctcct
tcttcttcttcaacagcaccgccaattcatcatcatcatcatcatcatcatcatcaccgg
aaggctcagcgtgagacgaagcgtagaaaactgctcctctgtcccgctcagctcgtcggc
gctttcgtcgccatggctgagcctcaaaccgcccaaggaatcgaactctgtgggctctta
ctcggatcgaccatcggagatcggttggtcgtcaatactttattgatcccccgccagatc
tcgaccgctaatagttgtcataccgtcgacgaggcccagacgttcgaggtccagagtcgg
gccggtttgctcaccctcggctggatccatacccatcctactcagacttgtttcctctcc
tcggtcgaccttcatacccatctctcttatcacctcatgctccccgaatccgtcgcgatc
gtttgtagtcccaataaacaccccagtgtgggcgtgttcaagttagtcgagccttccggc
gtcgacttcctccgacaatgtcccaacaatctggacgcgttccatccgcacgacatggcc
gacaaccttctctacaccacgccggcgagaaatgaatttgtgtttgtggagcctgggggg
cagcaggctgatgatgatgatgtcggcgacgacggtggtggtggtgggagcgtcggactc
gacttcgagatcatcgatttgcgcgggccggagtag

DBGET integrated database retrieval system