KEGG   Puccinia graminis: PGTG_09883Help
Entry
PGTG_09883        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
pgr  Puccinia graminis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PGTG_09883
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PGTG_09883
Peptidases [BR:pgr01002]
 Metallo Peptidases
  Family M67
   PGTG_09883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 731 aa AA seqDB search
MAHKQHDDHRSSPPRSIEELSGIAQVPFDARLAIKSYVRSCEMLYQQAKKDEEQLELAYI
YLSRAARIIIHDLPSHPDYHQLPPSYQAQLKADGLKYLEALLPIKSKLKHQHQLYQQQHS
FSPSQSSSLSNTPPQPHQHPKQKSSISDWTLIDSPELSYEPLLPKQQQQHCSPHKKLHKN
HHLSSPITRRSSSSKSSPSTCSDSSTSVLPSAAINNHRIVNPLVWPVELGNGLGRPMTVA
LPHHNRPSSHRNHHQLSVDLPDSSPPTREHPHSSKKNPLASSQPISSRSFRHLGLYELQD
PPSPSHQPSPPSLNRSATQKEQAQDSLKAKKQRASWADRRPLPASATTTDPQEPSQSLAR
SFRSLLRPRRLSWSSASPTAITKPRRAPSVESWASVQIPSPPPPPPPVGLESPAHILTPL
QQQQQQQQQQTRSRSRRGSLGEPASWRWLKALKSSPDPSSPSASQQPPSNGPLYTHFPAL
ISPELHPSRPRLPSLPSPSPSSSSTAPPIHHHHHHHHHHRKAQRETKRRKLLLCPAQLVG
AFVAMAEPQTAQGIELCGLLLGSTIGDRLVVNTLLIPRQISTANSCHTVDEAQTFEVQSR
AGLLTLGWIHTHPTQTCFLSSVDLHTHLSYHLMLPESVAIVCSPNKHPSVGVFKLVEPSG
VDFLRQCPNNLDAFHPHDMADNLLYTTPARNEFVFVEPGGQQADDDDVGDDGGGGGSVGL
DFEIIDLRGPE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggctcacaagcagcacgacgaccatcgatcatccccgccacggtcgatcgaagagctc
agtgggatcgcccaggttccgttcgacgctcgtctggcgatcaagtcctacgtccggagc
tgtgagatgctataccagcaggctaagaaggatgaggagcagctcgaactggcttacatc
tacctctccagagcagccaggatcatcatccatgacttgcccagccatcccgactaccac
caactaccacccagctatcaggctcaactcaaagcagatggactcaaatacctcgaagca
ctcctgcccatcaaatccaaactcaaacaccaacaccaactgtaccaacaacaacactca
ttcagcccatcccaatcttcctccctctccaacacacccccacaaccccatcaacacccc
aaacagaaatcatccatctccgactggaccctcatcgactcccccgaactaagctacgaa
ccactactcccgaaacaacaacaacaacactgctctccacataaaaaactccacaagaac
caccatctctcatcccccatcacccggcgctcctcttcctctaaatcatcaccctccacc
tgctccgactcgtccaccagcgtcttgccttctgctgcaatcaacaaccatcggatcgtc
aaccctttggtctggcccgtcgagctcggaaacgggctcgggaggcccatgaccgtcgca
ctccctcatcacaacagaccctctagtcacaggaatcatcaccagctctccgtcgatctc
cctgactcctctcctccgactcgagaacatcctcattcctccaagaaaaacccactcgca
tcgagccagccgatcagctccaggagcttccgtcatctcggcctctacgagctccaagac
cctcccagcccatctcaccaaccttctcctccgtctctcaatcgctctgcaactcaaaaa
gaacaagcccaggacagtttgaaagccaagaaacagagggccagttgggccgaccgacgt
ccactccctgcttctgccaccaccaccgaccctcaagaaccctcgcagagcttggcccgc
tcgtttcgcagtctgttgagaccccgaagactctcctggtcctccgcctcccccaccgcg
atcaccaagccccgtcgagctccctcggtcgagtcctgggcatccgtccagatcccctcg
cctcctcctcctcctcctcctgttggtttggagtccccggctcatatccttactcccctc
caacaacaacaacaacaacaacaacaacagactcggtctcggtctcgaagaggatcgctc
ggcgaaccggcgtcttggcgatggctgaaagccctcaaatcctcccccgatccttcttcc
ccttctgcttctcaacaaccgccgtccaatggcccgttatacacccacttcccagcccta
atatctcccgagcttcatccctctcgacccagactcccctccttaccttctccgtctcct
tcttcttcttcaacagcaccgccaattcatcatcatcatcatcatcatcatcatcaccgg
aaggctcagcgtgagacgaagcgtagaaaactgctcctctgtcccgctcagctcgtcggc
gctttcgtcgccatggctgagcctcaaaccgcccaaggaatcgaactctgtgggctctta
ctcggatcgaccatcggagatcggttggtcgtcaatactttattgatcccccgccagatc
tcgaccgctaatagttgtcataccgtcgacgaggcccagacgttcgaggtccagagtcgg
gccggtttgctcaccctcggctggatccatacccatcctactcagacttgtttcctctcc
tcggtcgaccttcatacccatctctcttatcacctcatgctccccgaatccgtcgcgatc
gtttgtagtcccaataaacaccccagtgtgggcgtgttcaagttagtcgagccttccggc
gtcgacttcctccgacaatgtcccaacaatctggacgcgttccatccgcacgacatggcc
gacaaccttctctacaccacgccggcgagaaatgaatttgtgtttgtggagcctgggggg
cagcaggctgatgatgatgatgtcggcgacgacggtggtggtggtgggagcgtcggactc
gacttcgagatcatcgatttgcgcgggccggagtag

DBGET integrated database retrieval system