KEGG   Puccinia graminis: PGTG_10272Help
Entry
PGTG_10272        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PGTG_10272
Peptidases [BR:pgr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PGTG_10272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 320 aa AA seqDB search
MSEGWCLTESDPAIFTILLSELGVSGLQVEELWSLDNQSLEQLKPVHALIFLFKYVNSDQ
RDPSKQAGEQQPAPPGTWFAHQVITNACATLAILNAVMNIPSTSSKIQLGQELSQLKEFS
VDLDSQMTGELLTNSERIRAVHNSFARPDPFQRDEPKQMSTEDAYHFITYLPLQGKLYEL
DGLNGLPVFHGKIPEGQSWTSLAREVIQNRINTYSSTEVHFNLMAVCEDRLNVLEERKAS
MTVDSMGYENLKMEIEAEEAKRKRWAEEVAIKRHNHIGLIHALMVGLAKHGSLAERVNLA
KQKMVDRQRNRTGGHEMQLD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaggatggtgtttgacagaatccgatccggctatcttcactatcttgttgtcc
gaactgggcgtctctggattacaggttgaagagctatggagtttggataatcagagtctc
gagcaattgaaaccggtacatgcgttaatttttctgttcaaatatgtaaattcggatcaa
cgagacccaagtaaacaagctggagaacaacaaccagcaccgccagggacttggttcgcg
catcaagtgattacgaatgcctgtgccaccctggccatcctcaatgcagtcatgaacatt
cccagcacgtcttccaagatccaactaggccaggagttaagccaactgaaggaattttca
gtggatctcgactcgcagatgaccggagaactcttgactaattcggagaggatcagagca
gttcataattcgttcgcacgtccggacccattccaacgagacgagccgaagcaaatgagc
actgaggatgcgtatcattttattacgtatctgccgctccaagggaagttgtacgagttg
gacgggctcaatggattgccggtcttccatgggaaaatccccgagggacagagctggacg
agccttgctcgcgaagtgatccagaaccggatcaacacgtattctagcaccgaagtgcat
ttcaatttgatggcggtatgtgaagatcgactgaatgtgttagaagaaaggaaggcgagt
atgacagtagatagtatgggctatgagaacctgaagatggagatagaggccgaagaagcc
aagcgaaagcgatgggcggaagaagtggccatcaagcgacacaatcatatcggcttgata
catgcgttgatggtcgggttggccaaacatggatccttggccgagcgggtcaacctcgcc
aaacagaagatggtcgatcgtcagaggaaccggactggcggacatgagatgcaattggac
tga

DBGET integrated database retrieval system