KEGG   Puccinia graminis: PGTG_10327Help
Entry
PGTG_10327        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
pgr  Puccinia graminis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PGTG_10327
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PGTG_10327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 631 aa AA seqDB search
MSWKTRGMALPFSSILSIYCLLLLQQSSNVTSQVLTASVPSYAPVSIECPSNQNILRLAG
SSTSKNQTLSQAEAGFRRGRKSVTAPLWRDFFINGPGKSTGYKSTALVSQKQNDWPVLGV
AYSGGGIRAALYAAGVMQTLDARTSASPIRGIFQLSSYFSGLSGGSWLVASAAASNFPIA
SELVSGWELEKDLVLPGGINAIRSAQFIDQIHDTSKLKKDAGYNISLTDLWGRALGYHFL
PGTTSDNFYTNSPTTAHGAGDLISGLRNMKTFQEFRAPLPILVSDHKPLNKSETNTSSVP
ASGSTYIPLSAPVYECSPFEFGSFDPQLSAFIPSELLGTSLSSGKPFIPSSVNKSSKPDP
NKRCVRGFDQLSFIMGSSATLFNAVTGVPAKYNEMFKKMIQKIADTALDRSFTARYPNPF
RGVNGAISFDRSKSDELVIVDGGENGENIPLNPLLAPARQVDVILAADASGDSNSSSAIG
AGWPNGKGMINTFLRVHKVLPAGTSNFPSVPLNPTVWEEKGYSSRPTFFGCNVSSKEGNG
GYPLVIYLPNSPSQTGYLTNTSTFKLQYSREDSSSFLQSVMESTTKPRIENKVDKDWSTC
LSCGLIDRSRNRLGITRSTACEICFKRYCYA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaagacgagaggcatggcactacccttttcatccattctttcaatttattgc
ttactgcttttacagcagagttccaatgttacctcgcaagttttgactgccagcgtgcct
tcctacgcccctgtcagcattgaatgtccatcaaaccaaaatatcttgagactagcaggt
tcctcaactagcaaaaatcagacattatcgcaggccgaggcaggctttcgcagaggtcgg
aaatcagttacagccccactctggcgggattttttcatcaatggacccggtaaaagtacc
ggctataaatctactgcactggtatcccaaaaacagaatgattggccggtgcttggcgtc
gcatactctgggggcgggatccgagcagcattatacgcggctggagtcatgcagacactt
gacgcaaggacgagcgctagtccaatccgtggaatattccagttgtcgtcctatttctcc
ggtctcagtggtggtagctggctggtcgcctctgcggcagcaagcaattttcccatagca
tccgaactggtctctggatgggaactagagaaagacttggtgctacccggcggaatcaat
gctatcagaagtgcacaattcatcgatcagatacatgatacctctaagctcaaaaaagat
gcgggttataatatttcgttgactgatttatgggggcgagcactaggataccattttcta
cctggaacaacatcagacaatttctatacaaattcaccgactacagcgcatggagcgggt
gatctaatctcgggcttgcgcaacatgaaaacatttcaagaatttcgagcacccctgcca
atattagttagtgatcacaagccattgaacaaatcagaaaccaataccagctccgttccc
gcctcgggatcaacgtatattccactttccgccccagtctacgagtgctcgccgttcgag
tttgggagttttgaccctcaactgagcgcttttatcccctcggaactcttgggtacaagt
ttgagttcgggaaagcccttcatcccttccagtgtaaacaaatcatccaaacccgatccc
aacaagagatgcgtgcgaggatttgatcaattgagcttcatcatggggagctctgcaaca
ttgttcaatgctgtgacaggggtgccagcaaagtacaacgagatgttcaagaagatgatc
caaaaaattgcagatactgctctggaccggtcattcaccgcccgatatcccaatccattc
cgaggtgtaaatggcgcaataagttttgatcgatcaaaatctgacgagttagtgatcgtt
gacggcggcgaaaacggcgaaaacatacccctcaatcctctgttagctccagccagacag
gtggatgtcatcttggcagcagacgcctcaggcgattcaaattcaagtagcgcgattgga
gctggctggcctaatggcaaaggtatgatcaatacgttcttacgagttcacaaagtgtta
ccggctggcacatccaatttcccttcagtcccacttaatcccacagtatgggaagaaaaa
gggtattcctcgcgtccaacattttttggctgcaacgtctcaagtaaggaaggaaatggc
gggtatccattggtgatttacttgccaaatagcccatcgcagactggctacttgaccaac
acgtcaaccttcaaactacaatattctagagaggattcaagttcatttcttcagtcggtc
atggaatcaacaaccaagccgaggatcgaaaacaaagtcgataaggattggtcaacttgc
ctttcctgtggattgatcgatcgatcaagaaaccgattaggaattactcggtctaccgca
tgcgaaatctgctttaagcgctattgttacgcatag

DBGET integrated database retrieval system