KEGG   Puccinia graminis: PGTG_10333Help
Entry
PGTG_10333        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K13333  lysophospholipase [EC:3.1.1.5]
Organism
pgr  Puccinia graminis
Pathway
pgr00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PGTG_10333
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PGTG_10333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 10526836
NCBI-ProteinID: XP_003329281
UniProt: E3KKN7
AA seq 643 aa AA seqDB search
MFYAAKARPTLFSSVLGFLLICLMNRKILVHSQVTTPATHATSYAPYRVQCPTEKQLLRM
SGSATTNSQTLSQEEQSFRNGRGSVTSPLWREFFTNGPGKNTGYQNTALMAQNQMNWPVL
GIAHSGGGERATLYGAGVLNALDSGTISSPIRGVYQLASYSTGLSGGSWLIASMTAHNYP
TVSSLLSRLKIEIDIILPGGSFQNSWQFFQNISIIVLQKKIAGFKTSLIDFWGIALGQHF
LPAVSTDDFYSTSFSTPRGAGMLLSGLRSTSALREFQKPLPIIISNHMPPNNTNDTVNPN
KLPIQGTTYIPLSAPIYEYSPFEFGSFDPQLSAFIPTEYLGTSLESGNPIDSSGGDFLSF
LSGAASGNKCVRGFDQMSFIMGSSAAVCNTLLSGGASDFPARYAAVINYLTNSIGDPEPL
LAHYPNPFKGVNGPMGFDRANSDELLIVDGGENGENIPLNPLLAPARNVDVIMALDASAD
TASNYPNGASMINTWLRTHRVFPSNAASFPPVPLQPQTWINKGFTTRPTFFGCNASSTQG
NGGYPLIVYLPNSPLSSSPTNSSTFQLQYSTKERDAFVHSVTNSTAYPLFGPKKTVDNEW
PTCLSCALIDRSRNRLNVTRSAACKKCFARYCYQDGVLQPTSQ
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgttttacgccgccaaagccaggccaactttgttctcatcagtcctcggatttctgttg
atatgtttgatgaatcgtaagatcctggtgcattcacaagtaacgactccggcgacacac
gccacttcttacgccccttatcgagttcaatgtccaaccgagaagcagctattgaggatg
tcaggctctgcgacgactaacagtcaaacgttatcacaagaagagcaatcttttcgcaat
gggcgtggatcggtcacaagcccactttggcgagagtttttcaccaacggacctggcaaa
aacactggttatcaaaacacggcactgatggcccaaaaccaaatgaattggcctgtactc
gggatcgcacattccggtggcggtgagcgggcgactttgtacggagctggagtattgaat
gcacttgattcagggaccatttcaagtccaatccgaggagtgtatcaattagcatcgtat
tccacaggcctcagtgggggaagctggttaatcgcctcaatgactgcacacaactacccc
acagtatccagtttgctctccaggctgaaaatagaaattgatattattctacccggaggg
tcttttcaaaacagctggcaattcttccaaaatatatcgattattgttctccagaagaaa
attgctggcttcaagacttcgttgatagacttttggggtatagcccttgggcagcacttc
ttgcctgcggtgtcaactgatgacttttactcgacctcctttagcactccgcgtggtgcc
gggatgcttttgtctggcttgcgcagcacatcagcccttcgggagtttcagaaaccgctg
ccaataattatcagtaatcacatgccaccgaacaataccaacgacacggttaacccaaac
aaacttccgattcagggaactacatacatccccctttcggctcccatatatgaatattct
ccattcgaatttggaagcttcgacccccaattaagcgcgtttatccctactgaatacctg
ggaacttctcttgaatcaggaaacccaattgactcttcagggggcgacttcttatccttc
ctgtctggtgcagcctcaggaaacaagtgcgtccgcggttttgatcaaatgagctttatt
atgggaagctcagcggcagtctgtaacactttgctcagcggcggtgcatcagatttccct
gcacgttatgctgcggtgataaactacttgaccaatagcattggagatcctgaaccgttg
ttggcccattatcctaacccctttaagggtgtgaatggtccgatgggatttgaccgagca
aactctgatgagttgctaattgtagacggcggcgagaatggggagaacatacctctcaat
ccattgttagctccggcaagaaacgttgatgttatcatggccctagacgcgtcggctgac
accgcttcaaattatcccaatggagcatccatgattaacacctggctccgaacccacaga
gtttttccttcgaacgccgccagttttcctcccgtcccattgcagccccaaacgtggatt
aacaaaggattcaccacccgacccactttttttggctgtaacgcgtcaagcacccaaggg
aatggcggttatcctttgatcgtttatctacccaacagtccactttcctcttccccaact
aactcatcgactttccaactgcaatactctaccaaggagagggacgcatttgtgcactcg
gtaacgaattcaacagcataccctctttttggaccgaagaagacagtggataacgaatgg
ccaacctgcttgtcctgtgcactcattgatcgttcacgaaaccgtctgaatgtcactcga
tcggccgcttgcaaaaaatgctttgcgcggtactgctatcaagatggtgttcttcaaccc
accagccaatga

DBGET integrated database retrieval system