KEGG   Puccinia graminis: PGTG_10644Help
Entry
PGTG_10644        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pgr  Puccinia graminis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PGTG_10644
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PGTG_10644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 537 aa AA seqDB search
MQASVGLELISSTWAHSIHNHKSSISSQPTLTDDDHNQSSSSSSSLSDLEDESEPPVEYS
AAPVHAEGVPQSNTKLSAKKYRTPEFGDSLFELLRSQLKLPGWSNLSDQYKSSITISKVS
GSLTNAVFFVSCTYNSSSQPAIQLPDQESPPTVLLRIYGPSSGTLISRKEELHLLHTLSA
KYGIGPLLLGTSLAYTWVWNNITRWQHEATKVFVDIAKALEKLGIQPTSNPSLPATDGED
PLERFRATPFPLSSPQALAELVKIVDLPRLILEMKSYRAWIYNHERIHGKSPRIFSHNDT
QCGNLLLRQDDDPLLREQPQDQIMVIDFEYASANPRGFDIANHFHEWCADYHHPTHSYSL
TRHGNYPTYLERKRFYRAYLGIDCEYSKTNSAIEKEQSDPKANSYIKRFKDCEISDFNLD
EPSDLATPKDTNRVPGTNAGQGVVAEKEDGEEDGRVMSLEQDVNLWSPASHAMWALWGLV
QARDDLKVQLDRWLTAPTPSLSSNSMDEFEFDYFSYSAERIILFRRLLAELNVPLVL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctagcgtcggactcgaactcatcagctcaacctgggctcattccatccacaat
cacaaatcttctatcagctcacagccaaccctgaccgatgatgaccacaaccaatcatca
tcatcatcatcatccctatccgatctagaagacgaatcagaacctccagtcgaatattct
gccgccccggtgcatgccgagggcgtaccccaatctaataccaaactatctgcaaagaaa
tatcgtacccctgaatttggtgacagtctattcgagctcctgcgctctcaactcaagctg
cccggatggtcaaacctctctgatcaatacaagtcatcaatcacaatctccaaagtcagc
ggaagtctcaccaacgccgtcttcttcgtctcctgtacatacaactcaagcagtcaacca
gctatccaactacccgaccaagaatcgccacccactgtgctcttacgaatctatggtcca
tcttcgggcacattgatctctcgcaaggaagaattgcatcttttacataccttatccgct
aaatatggaatcgggcccttgttactcggcacatcccttgcatacacctgggtttggaat
aatatcactcgttggcaacatgaagctaccaaggtgtttgtcgatatcgctaaagcgctc
gagaaacttggaatccaaccaaccagcaacccatcccttccagcgacagacggagaagat
cccctcgaacgattcagagcaactcccttccctctatcatcccctcaggctctggctgag
ctcgtcaagattgtcgacttacctcgtctcatccttgaaatgaaatcctaccgagcctgg
atctataatcacgagagaattcatggtaaaagtcctagaatctttagtcacaatgatacc
cagtgtgggaatctgttgctacgtcaagacgacgatcctctgttgagggaacaacctcaa
gaccagatcatggtcatagattttgaatatgcctcggcaaatccgcggggttttgatata
gcaaatcattttcatgagtggtgtgcagattaccatcaccccacgcactcctattccctt
acaagacatgggaattatcccacgtatcttgaacgaaagaggttctatcgagcatacctt
ggaatcgattgtgaatacagtaaaaccaattcagcgattgagaaagaacagagcgatccg
aaggccaactcgtacatcaaaagattcaaagactgtgaaatcagcgacttcaatttggac
gagccgagcgatttagccaccccaaaggatactaatcgtgtgcccgggacgaacgctgga
caaggagtagtagccgagaaagaggatggggaggaagacgggcgagtgatgagtttggag
caagacgtcaacctttggagtccagcctcgcatgcaatgtgggctctctggggtctagtc
caggctagagacgacttgaaagtccagctcgatcgttggctcaccgctcctactccctcc
ctctctagcaactctatggacgaattcgagttcgactatttttcctactcggctgaacga
atcatcctttttcgtagattactcgccgaactaaacgtccctctcgttttgtga

DBGET integrated database retrieval system