KEGG   Puccinia graminis: PGTG_10673Help
Entry
PGTG_10673        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PGTG_10673
Peptidases [BR:pgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGTG_10673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 690 aa AA seqDB search
MAAVASSTHLHLHLNHLIINHDKQPPTNNNNNSNKLSSTSKHHPEPTQATDQANTRTTTN
PRTQPSQQQLGKLWEQALQQPIKFIKSSNQLNLTQIPYQPINQPQPATQPTRPSNSANTN
PTTTSNQSNLTSSSASSLSEKISPNSNPITQSTSSRLSQSNSSASSQVATYWIRPQPIGP
GFYNTGNTCFLNATLQALVHTPALAIGLMDRDEHSPESCDLARAKKFCALCRMYRLVNMC
FDKASYGSHAIEPSPINRALSKFAPTMRGGRQEDAHEFLRLLVEAMQNGALQGRAEKAKQ
KQKESTFVHRMFGGKLRSRVVCEHCNTPSDTFDNFLDLSLDISQANSVSSALKAYHKFDR
LRGANQYKCDKCKCLRDAKKSMSVFSAPPILTLHLKRFNFRGRKINKRVNFEDSLDLKPA
MSNESDITGYKLYAVVCHRGQSNKSGHYYAHVKASNGKWYVADDSTVESISDSRTVLANE
HAYILFYARDRESLLSAAIAGNRQSTSTTTNSDGGNRGSFTKRKPSISDDRHSQVNGVAE
KTGKHSNRTENGHKRVRTGSINSQESPAKSFIGPVIPRQSLPSFKFKDTHQDGSDSTRGS
PAKAKQNPEQDAHQSGRSSLTRSPSSHSNSNHNSNDQQDQLSDDQVEQPMNQMKKKKRNR
KPKSKRRKIVNIAGTPVNQVPSFKPRLITG
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgttgcctcttccactcacctccacctccatctcaaccatctcatcatcaac
catgacaaacaaccacccacaaacaacaacaacaacagcaacaaactcagtagcaccagc
aagcaccacccagaaccaactcaagcaaccgaccaagcaaacactagaacaactacaaac
cccaggactcaacccagtcagcaacaactcggcaagctgtgggaacaggcactccaacag
cccatcaagttcatcaaatcctcaaaccaactcaatctcactcagataccctaccaaccc
atcaaccaacctcaaccagctactcagccaactcgcccctccaactcagccaacacgaac
cctaccaccaccagcaaccaatccaatctcactagctcatcagcatcatcattatccgaa
aagatcagtcccaactcaaatccaatcacccaatcaacgagctcccgactatcccaatcg
aactcgtctgcctcctcacaagttgcaacctattggattagaccccagcctatcggaccc
ggcttttataataccggcaatacttgcttcctaaatgctactctccaagccttggttcat
acgcccgcactggccatcggtctcatggacagagatgaacattctccagagtcatgcgat
ttggctcgcgccaagaagttttgtgcgctttgccgaatgtatagactcgttaacatgtgc
ttcgataaagcttcatatgggtctcatgcaatcgaaccttcacctatcaacagagctctc
tcgaagtttgctcctactatgaggggcggtcgccaagaagatgcacacgagtttttgaga
ttgctagttgaagcgatgcagaatggtgctctacaaggtcgggccgaaaaggccaaacaa
aagcagaaagaatccacttttgttcatcggatgtttggcggaaagctgagatcaagagtc
gtctgtgagcattgtaatacaccaagcgatacgttcgataactttttagacctgagcctc
gacatctctcaagccaacagtgtatcgtcagctctgaaagcttaccacaaatttgatcgt
ctgagaggtgcaaaccagtacaaatgcgacaaatgcaagtgtttacgcgatgccaagaag
tccatgtccgttttctccgcccctccgatcctcaccctacacttgaagcggttcaacttc
cgaggccgaaagatcaacaaacgagtgaattttgaggactcgctggatttgaagccagcg
atgagtaacgaatctgatatcaccggttacaagctctacgccgtcgtttgtcatcgcggc
caatctaataagagtgggcactactatgcacacgtcaaggcttccaatgggaagtggtat
gttgcggatgattcgaccgtcgagtcgatttctgactcgagaacagtcctggcaaacgaa
catgcatatattctgttttacgctcgcgatcgagagagcttgctatctgctgcaatcgct
ggcaatcgtcagtcaacatcgacgacaacaaactcggatggtggcaatcgcgggtcattc
accaagaggaagccttcgatttccgatgatagacattcccaagtcaacggagtagctgaa
aagactggcaaacattcaaatcgaaccgagaatggacataaacgcgtaaggacaggatcg
attaacagccaagagtcacccgccaagtcattcatcggcccagtcatccctcgacaatca
ttgccatccttcaagttcaaggacacccatcaagatggctcggatagtacacgaggatca
ccagccaaggccaagcaaaatccggaacaggatgctcatcaatccggaaggagctccctt
accagatcaccctcctcgcactccaactcaaaccacaactcgaacgatcagcaggaccag
ctttccgatgatcaagtcgagcaaccaatgaaccagatgaagaagaagaaacgcaaccgt
aaaccgaaatcgaaacgtcgcaaaatagttaatatcgccggaaccccagtcaaccaggtc
ccgagcttcaaacctcgtctgatcactggttaa

DBGET integrated database retrieval system