KEGG   Puccinia graminis: PGTG_10743Help
Entry
PGTG_10743        CDS       T02226                                 

Definition
CMGC/DYRK/DYRK2 protein kinase
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
pgr  Puccinia graminis
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PGTG_10743
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PGTG_10743
Protein kinases [BR:pgr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PGTG_10743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1917 aa AA seqDB search
MKSIESLKDFKSSMNIFKGAAGKKQHDRMPSESSCPQSNQPHHDPDKHPRHQPSKPEPIH
HHQQQQQHHHHHHHHHTQSNIASSNKPTQSNPLSSFSHHSSPSTIAHSILRSASSGLVST
DLEDMDIQQVAAQNDDTAEALRKLDGLSSPRATRHSLKDPNLSNPHHNRPTSTGPRRRSI
TSRSNSRPSSPSAASVKDRSAPKDRSKLTQDPPSTTSLKKTRTRSIASSKDSPVTFTDDS
YVLQSDHPISPSIQRSTFQSSNTATTTTAATTHSPSHLAHHQSLTSAHHPTKTVDGLSSA
SSSPRQVFHSIAPKGPHTKPTTQAELDGNSSSPKIALSSASSPAIQSNWKRGSSSSTSYT
TGATTTTAESRESTLATSVSSPSFPPHHHQQQHHHRHSQSNTTVPSRSSPTKSRSSVGSE
ASSVYSNNCPGADTGRHLERSNSSNLTTDTGEKISSIPPVPPLPKDYETFKAQPQSRRPS
HSSIQLTNNTRTNNPQTDSLHLPHKLLPPEGASHDQREPFSPSVATIDSQLSVNTPSSGA
SATSRFLHSLTSQKSPEDHIGSNLPSSHPSNLKQNKKWSLSAALGMNKTGHSSRDSVHDD
HHPIAHPVLSPANSHHQLCESREAVGGLATHTKRGSWLTGTHHPAPESLHSSAHNQSNRP
ESSFHPSGQTDASRNRKESGSSILTTDTTTTTAGFAVPALKPSIGSGLSSRRTPSGIPFF
SRKTSGNQSVNLSDKSTTNLTESTISHDSSNGGLKNNKATKALEKTQNEGEVQGRRSMMS
LNVFIRNSVHRRPTLSSSKISPSSVSHPISSPNETAVGSKSVSSRHSLKSMPAKSSPIRE
THAPQSAPKKLSISILNGVNSETPESHLNEATSPKKSTLGSKASNLIGRIRGKEKVAVPP
PLPPLQMSAIHSTTTNRVASITSPNNSFSSTASKRRSIDYPTSSSLSSRAPRVRTLKEST
SSLRKGLPTIDASPLRMEEELSDDGSKSVINQQTAPVRQQVSKENINDRHDHPIEKPPVS
PNSYRPQSNASISLTPTKIPRAVFRPQKNAMSPAPKIQSDDYYQASNTDSLGSPKRREQV
PASNSENQEHSNDFGVLTGHQPVTLNSKRASGIQGSLIPRSRSGASNASKTLNRLSNNDL
KAESNSSPTKPSMMSQANTHNNEPDSANEDFANAQQDTSAAARLAAARRTVAKSQEVQAA
RAASRRLSTTHASVLGDQSTVSEFGTSASSGVVPSSRSSRTIASKLTIPSRMSRSSTTPS
MLSASEAVGHSSRSSPGHGLRVRTTDSKGNMSPTIGEEETKGDEEMAQYVARQRSKKLMS
GMTPAEVAKLFEFPKPNEPTQPMTTQEALRLYKNYLSDYEKGEILGYEKIYYVGSESAKK
MASEDKPAQNYGYDDERGDYQIVKNDHLIYRYEIVDVLGKGSFGQVLQCRDHRTGEMVAI
KIIRNKRRFHHQALVEIRVLENLLSWDPEDKHCVLKMTDHFTFRGHLCIVNELLSINLYE
LIRNNSFNGFSTTLIRRFTIQILTSLSLLRHHRVVHCDLKPENILLKHPQKSAIKTIDFG
SSCFENEKVYTYIQSRFYRSPDPGETESEQLACIMEVLGMPDKYLVDRSSRRKLFFDSTG
TPRPVVNSKGRRRRVGSKTLQSVLKTDDELFVDFIAKCLAWDPERRLKPDPAMRHPWILA
GRARPAVAQLSASISNLQQQQQQQHTSGSLTSSSSVNSSSARLAHGRFNSGSGSIHISSP
RRKQVHLASSTSSSAHTGSNGPSAPTISQLPHLSAANSGSSSSTTTTTTTIGPGRNSVGY
RNRTQSSSTRQSLKTLHSHQQNHHHHHQPSSSIIHPSSSASSSTTTTTSSNHHLNLTGNG
KLNPAASSSNSSSTTTTAAAAALNSNSNSNSNSSSSSARVGHPHSLARQSLPVRAGP
NT seq 5754 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaatcgaatccctcaaggacttcaaatcctctatgaatatattcaaaggcgcc
gctgggaaaaagcaacacgatcgaatgccgagcgagtcttcatgccctcaatccaatcag
cctcatcatgatccagacaaacaccctcgtcatcaacccagcaaacccgagcctatccat
catcatcaacaacaacaacaacatcatcatcatcatcatcatcatcacactcaaagtaac
atcgccagttccaacaaacctacccaatctaacccactctcatccttctcacatcactcc
tcaccctcaacgatcgcccattccattctgagatccgcttcgtctggcttggtttctacg
gacctagaagacatggatatccaacaggtggccgcccagaacgatgacacagccgaagcc
ttacgcaagctcgacggtctatcatcaccacgagccaccaggcactctctcaaagaccct
aatctatcaaatccccaccacaaccgtcctacttctaccggccctcgtcgtcgttccatc
accagccgttccaactctcgtcccagctcaccatcagccgcgagtgtcaaggatcgaagt
gcccccaaggatcgatcaaaactcacccaagatccaccttctacaacctccctcaagaaa
acacgtactcggagtatcgccagtagcaaggactcgccagtcaccttcaccgacgattcc
tacgtccttcagtcagatcatcctatctcaccctccatccaacgttcaactttccaatcc
tcaaacacggctaccaccaccaccgccgccaccactcattctccctcccatctcgctcac
caccaatcactcacttctgctcatcatcccactaaaaccgtcgatgggctatcatcagct
tcgagtagtcctcgtcaagtttttcactcgattgctcccaaaggaccacataccaaaccc
accacccaagctgaattggacggcaacagctcctctccgaagatcgctctctcatcggcc
agctctcctgccatccaatctaactggaaacgcggttcgtcatcctcgactagctatact
acaggtgctaccaccaccaccgccgagtcaagagagagcacccttgctacctcagtctct
tccccgtctttcccccctcatcatcaccaacaacaacatcatcatcgtcactcgcagtct
aacactactgtccccagtcgctcctctcccaccaagagtcgtagcagtgttggaagcgaa
gctagttcggtttatagcaacaattgtcctggagccgacacaggccgtcatttggaacgt
tccaattcatccaatctcaccaccgatactggcgagaagattagcagcatcccacccgtg
ccacctctacccaaagattatgaaaccttcaaggcccaacctcaaagccggcgtccatct
cattcatcaatccaactgacaaacaacacgcgaactaacaaccctcaaacagactctctt
catcttccccataaactcttaccccccgaaggagcttcacacgatcagcgcgaaccattc
agtccctccgttgctaccatcgactcacaactctcagtcaacactccttcgagtggcgct
tcagccacctcaagatttctacactcactcacctctcagaagagtccggaggatcacatt
ggctcgaacctacccagctcacacccctccaatctgaagcagaataagaaatggagccta
tctgccgccttgggaatgaacaaaaccggacactcgagtagagatagtgtccatgacgat
catcatccgatcgctcacccagtcctctcgcctgccaattctcaccaccaactctgtgaa
tccagagaagccgtaggcggtttagcaactcacacgaagcgcggttcatggcttactgga
actcatcaccctgcccctgaatctctacattcaagcgctcacaaccaatcaaatcgcccc
gagtcatcctttcacccctccggccagaccgacgcaagtcgaaatcgtaaggagagtggt
agtagtattctgaccactgatactactactactaccgctggtttcgctgtaccagcactc
aaaccatctattggcagtggcctcagctcccgtcgcacgccatctggcattcccttcttc
tcgcgcaagacgtctgggaaccagtcggtcaatctctccgacaaatcaaccaccaatctg
acagaatcgaccatcagtcacgatagctcgaatggtggattgaagaacaacaaggcgacc
aaagcacttgagaagactcaaaatgagggcgaagttcagggtcggagatcgatgatgtca
ttgaacgtattcatcaggaatagcgtccatcggcgacccaccctatcgagctcaaagatt
tctccatcatctgtttctcatccaatctcctctccaaacgagaccgccgtcggctcgaaa
tctgtctccagccgacattcattaaaatccatgccggccaagtcctcaccaattagggaa
actcatgccccccaaagcgcccccaagaagctctcgatcagtattctcaacggtgtcaat
agcgagacccccgagtctcatctcaacgaagccacttcaccaaagaaatccactctaggc
tcgaaggcctcaaacctgattggtaggataaggggaaaagagaaagtcgcagtaccacca
ccactaccacctttacaaatgtcggccattcattccactaccaccaaccgagttgcctcg
attacctctcccaacaatagcttctcatcgacagcctcgaagcggcgtagtattgattat
cctacatcctcctctttgtcctcccgagccccgagagtacgtaccctgaaagagtccacg
tcctctctcagaaaaggactaccgacgatcgatgcctcgccattgaggatggaggaggag
ctaagtgacgacggatcgaaatcagtgatcaaccagcagactgcaccagtccgacagcaa
gttagtaaagagaatatcaatgatcgccatgatcatccgattgagaagccacccgtttct
cccaattcttatcgacctcaatctaatgcttccatttctttgactcctaccaaaattcct
cgcgccgtctttcgccctcagaaaaatgcaatgagtcctgcgccgaagattcaatctgac
gattattatcaagcttcgaataccgattccttggggagtcccaaacgcagagaacaggtc
ccggcgtctaattcagagaatcaagagcattccaatgattttggtgtcttgactggtcat
caaccggtcactctcaacagcaaacgcgcctcggggatccaaggatctttaatacccaga
tcacgctcgggagcatcaaatgcaagtaaaacgctcaaccgactatccaataacgatctg
aaggccgaatcgaactcttcaccaaccaaaccatcgatgatgagtcaagcaaatactcat
aataatgagcccgattcagcaaatgaagattttgcgaatgctcaacaggatacatcagct
gcagccaggctagccgccgcaaggagaacggtggccaagtcacaagaagtacaggcggcc
agggcagcctcgagaagactctcgacgactcatgcctcagtactcggagatcaatcgacc
gtttcagagtttgggacatcggcctccagcggggtggtgccctcctcccgttcttcaaga
acgattgctagcaagctcaccatcccatcgcgaatgtctcgctcgtctacgaccccttcg
atgctcagtgcttccgaagccgtcggacatagttcgcgctcctcaccgggacacggtctc
agggtacgaacgacggattcgaaggggaacatgagtccgacgattggcgaggaggaaacc
aagggagatgaagagatggcccaatatgtggctcgacagcggagcaagaagttgatgagc
gggatgaccccagccgaagttgccaaactgttcgaattccccaagccgaacgagcctacc
caaccgatgacgacccaagaggccttaaggttatataagaactatctctcggactacgag
aaaggcgagatcttaggctatgagaagatatattacgtcggctcggagagtgccaagaag
atggccagcgaggacaagccagcgcagaactacggctacgacgacgagcgcggtgactac
cagatcgtcaagaacgaccatctcatctaccgctacgagatcgtcgacgtcctcggcaaa
ggctccttcggacaggtcttgcagtgtcgagatcatcgtactggcgaaatggttgccatc
aaaatcattcgtaataaacgcagatttcatcatcaagccttggttgaaatcagagtgctt
gagaacttattaagctgggacccagaagataaacattgcgtattgaagatgaccgatcac
ttcacgttccgaggccacttatgcattgtgaacgagttgttgagcatcaatctctacgag
ctcatccggaataattccttcaacggcttctcgactaccctcatccgtcgcttcaccatc
cagatcctcacctctctctccctacttagacaccatcgtgtcgtccattgtgatctcaaa
ccagagaatattctgctcaaacatcctcagaaatcggctatcaaaactatcgactttggt
tcctcttgtttcgagaatgagaaagtttatacttatattcagagtcgtttttatcgctct
cctgatcctggagagacagaatcagagcagttggcatgtataatggaagtcttggggatg
ccggataaatatctagtcgaccgaagttcgcgacggaagttattttttgactcgactggc
acgccgcggccggtggtgaactcgaaggggcgccgtcgccgtgtgggctcgaagacgttg
cagtcggtgctcaagacggatgacgagttgtttgtggactttattgccaagtgtctggcg
tgggacccggaacggcggctgaagccggacccggcgatgcgccatccttggatccttgcc
ggccgggctcggcccgcggtcgcccagctctcggcgagtatcagtaacctccagcagcaa
caacaacaacaacatactagtggtagcttgacctcgtccagctcggtcaactcctcgtct
gccagactcgcccatggaagattcaactccggctccggctccatccacatctcttcgccc
cgtcgcaaacaagtccatctggcctcctcgaccagctcttctgctcacaccggctcgaac
ggaccttctgctcctacaatctcccagctccctcacctctctgctgccaactctggatca
agctctagtactactacgacgacgactactatcgggccgggtagaaatagtgtaggatat
cggaacaggacgcaatcttcatcaaccagacaatcgcttaaaactctccacagccatcaa
caaaatcatcatcatcatcatcagccttcttcctcaatcatccatccatcctcctctgct
tcctcctctactactacgaccacctcttcgaatcatcatcttaatcttaccgggaatgga
aaacttaatcctgctgcttcttcgtctaatagtagtagtactactactactgctgctgct
gctgctttgaattcgaattcgaattcgaattcaaactccagctctagctctgctcgcgtc
ggccatcctcattcattggcccgtcaatctttacccgtcagagctggaccttga

DBGET integrated database retrieval system