KEGG   Puccinia graminis: PGTG_10836Help
Entry
PGTG_10836        CDS       T02226                                 

Definition
tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
pgr  Puccinia graminis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pgr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pgr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pgr00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 724 aa AA seqDB search
MAAQLRDVFAQKASRELPVFVTFITAGYPNPESTVPLMLAMEAGGADIIELGVPFTDPLA
DGPAIQESNNVALSHNVDYRKCLQFVSEARSQGLKTPVILMGYYNPLMAHGEQASIDDAK
QAGANGFIVVDLPPEEAVKFRTLCTSSGLSYVPLIAPTTTDSRIGFLSSIADSFMYVVSK
LGTTGATEKVATSLPDLISRIRKFSHTTDANKSIPLAVGFGISTADHFDHVGGLADGVVV
GSKIIEVLKLNQGEGAAKAVQQFCEGLCGGKTGRPRKGPINIAITNLVSQVSTLMTNGTN
GTNGVNGIARPPVNGTSKQPTPETSLPYRFGEFGGQYVPEALVDCLLELETCHREAMADP
KFQAEFKSYYGYMNRPSGLYFAERLTEHVGGAKIWFKREDLNHTGSHKINNAVGQILLAR
RLGKTRIIAETGAGQHGVATATVCARFGMECVVYMGAEDARRQSLNVFRMKMLGAQVVAV
TSGSQTLKDAINEAMRDWVTNVSTTHYLVGSAIGPHPFPTIVRDFQSVIGREIKDQLLAE
IGKLPDAVIACVGGGSNAIGTFHPFINEKSVRMIGVEAGGSGTDTDRHSATLSKGTKGVL
HGVLTYILQSSSGQISETHSISAGLDYPGVGPEHSFLKDAGRAEYRVATDLEALKGFRLC
VQFEGIIPALETAHAIWSTAEVAKELGKDANIVMCLSGRGDKDVEQIAQQLPKFADALDW
HISP
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccaacttcgggatgtcttcgcccagaaagcgagcagagagctcccggtcttt
gtcacttttatcactgcgggttatcctaaccccgaatcgaccgtcccgctgatgttggcc
atggaagccggaggcgccgatatcatcgaattgggcgttcctttcacggaccctttggcc
gatggacccgccatccaagaatctaacaacgtcgccctcagtcataatgtagattaccgc
aagtgtttgcaattcgtttctgaagccagatctcagggattgaaaaccccggtcatctta
atgggttactacaaccctctcatggcccatggagaacaggcctcgattgacgatgccaaa
caagccggtgccaacggattcattgtcgttgatctaccgcctgaggaggccgtcaagttt
cgaaccctttgtactagctctgggttgagctatgtgcctctaattgcacccacaacgact
gactctcgaatcggtttcttgagttcgatagccgattcatttatgtatgtcgtctccaag
ctgggtaccacaggtgcaactgaaaaggtagccacatcactgccagatctaatatctcgg
attcgaaaattttctcatactaccgatgccaacaaatcgatcccattggccgtcggtttc
ggcatctcaacggcagatcattttgaccatgtcggagggctcgcagatggagtcgtcgtg
ggatcgaagataatcgaggtgttgaagctcaaccaaggcgaaggtgcggccaaggccgtg
caacagttctgtgaaggcttgtgtggcgggaagactggtcgtccacgcaagggacctata
aatattgcaatcaccaatcttgtctcacaggtctcgactctcatgaccaatggtaccaac
ggtaccaatggtgttaatggtattgcccgcccacccgtaaatggcacctccaaacaaccc
actcccgaaaccagtttgccctatcgatttggcgagttcggtggtcaatacgtccccgaa
gccttggtcgattgtttgctcgaattggagacttgtcaccgtgaggcgatggccgatccg
aagttccaggccgagttcaagagctactacggatacatgaaccgtccttcgggattgtat
ttcgcagaacgcctgaccgagcatgtcggtggagccaaaatctggttcaagcgtgaagac
ctcaaccacacgggttctcacaagatcaacaatgccgtcggccagatccttttggctcga
cgattgggcaagacccggatcatcgctgagactggcgccgggcaacatggtgttgcaaca
gctaccgtctgcgcaaggttcggtatggaatgcgtcgtttacatgggtgcagaggatgcc
cggcgacaatctttgaacgtcttccgaatgaaaatgctcggagctcaagtggtcgcagtg
accagtggcagccaaaccctaaaagatgcaatcaacgaagccatgcgtgattgggtgacc
aatgtcagcacaacacattatctcgttggttcggccatcggccctcatcctttccctaca
atcgtccgggacttccaaagtgttatcggacgagagatcaaggatcagctgctggctgaa
ataggtaaattgccagacgcagtgattgcgtgtgtgggtggtggaagtaacgctatcgga
actttccatccgttcatcaatgaaaagagcgtgcgaatgatcggtgtcgaagctgggggg
agtgggacggataccgaccgacattcggcgacgttatccaaagggacgaagggcgtgctc
cacggtgtgctgacctacatcctacagagctccagcgggcagatctcggagacccattcg
atctcggccggactggattacccgggtgtcgggccggagcactcattcttgaaggacgcc
ggtcgggctgagtaccgtgtggctaccgatctcgaggccttgaaaggattccgattgtgc
gtccagttcgaaggtattatccctgcactcgaaactgctcatgccatctggagcactgcc
gaggtggctaaggaacttgggaaggatgccaacatcgtgatgtgtttatctggcagagga
gataaggatgttgagcagattgcacaacagttacccaagttcgctgatgctctggattgg
cacatttcaccttga

DBGET integrated database retrieval system