KEGG   Puccinia graminis: PGTG_10836Help
Entry
PGTG_10836        CDS       T02226                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
pgr  Puccinia graminis
Pathway
pgr00260  Glycine, serine and threonine metabolism
pgr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
pgr01130  Biosynthesis of antibiotics
pgr01230  Biosynthesis of amino acids
Module
pgr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGTG_10836
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PGTG_10836
Enzymes [BR:pgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PGTG_10836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA PALP
Motif
Other DBs
NCBI-GeneID: 10526644
NCBI-ProteinID: XP_003329096
UniProt: E3KK52
AA seq 724 aa AA seqDB search
MAAQLRDVFAQKASRELPVFVTFITAGYPNPESTVPLMLAMEAGGADIIELGVPFTDPLA
DGPAIQESNNVALSHNVDYRKCLQFVSEARSQGLKTPVILMGYYNPLMAHGEQASIDDAK
QAGANGFIVVDLPPEEAVKFRTLCTSSGLSYVPLIAPTTTDSRIGFLSSIADSFMYVVSK
LGTTGATEKVATSLPDLISRIRKFSHTTDANKSIPLAVGFGISTADHFDHVGGLADGVVV
GSKIIEVLKLNQGEGAAKAVQQFCEGLCGGKTGRPRKGPINIAITNLVSQVSTLMTNGTN
GTNGVNGIARPPVNGTSKQPTPETSLPYRFGEFGGQYVPEALVDCLLELETCHREAMADP
KFQAEFKSYYGYMNRPSGLYFAERLTEHVGGAKIWFKREDLNHTGSHKINNAVGQILLAR
RLGKTRIIAETGAGQHGVATATVCARFGMECVVYMGAEDARRQSLNVFRMKMLGAQVVAV
TSGSQTLKDAINEAMRDWVTNVSTTHYLVGSAIGPHPFPTIVRDFQSVIGREIKDQLLAE
IGKLPDAVIACVGGGSNAIGTFHPFINEKSVRMIGVEAGGSGTDTDRHSATLSKGTKGVL
HGVLTYILQSSSGQISETHSISAGLDYPGVGPEHSFLKDAGRAEYRVATDLEALKGFRLC
VQFEGIIPALETAHAIWSTAEVAKELGKDANIVMCLSGRGDKDVEQIAQQLPKFADALDW
HISP
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccaacttcgggatgtcttcgcccagaaagcgagcagagagctcccggtcttt
gtcacttttatcactgcgggttatcctaaccccgaatcgaccgtcccgctgatgttggcc
atggaagccggaggcgccgatatcatcgaattgggcgttcctttcacggaccctttggcc
gatggacccgccatccaagaatctaacaacgtcgccctcagtcataatgtagattaccgc
aagtgtttgcaattcgtttctgaagccagatctcagggattgaaaaccccggtcatctta
atgggttactacaaccctctcatggcccatggagaacaggcctcgattgacgatgccaaa
caagccggtgccaacggattcattgtcgttgatctaccgcctgaggaggccgtcaagttt
cgaaccctttgtactagctctgggttgagctatgtgcctctaattgcacccacaacgact
gactctcgaatcggtttcttgagttcgatagccgattcatttatgtatgtcgtctccaag
ctgggtaccacaggtgcaactgaaaaggtagccacatcactgccagatctaatatctcgg
attcgaaaattttctcatactaccgatgccaacaaatcgatcccattggccgtcggtttc
ggcatctcaacggcagatcattttgaccatgtcggagggctcgcagatggagtcgtcgtg
ggatcgaagataatcgaggtgttgaagctcaaccaaggcgaaggtgcggccaaggccgtg
caacagttctgtgaaggcttgtgtggcgggaagactggtcgtccacgcaagggacctata
aatattgcaatcaccaatcttgtctcacaggtctcgactctcatgaccaatggtaccaac
ggtaccaatggtgttaatggtattgcccgcccacccgtaaatggcacctccaaacaaccc
actcccgaaaccagtttgccctatcgatttggcgagttcggtggtcaatacgtccccgaa
gccttggtcgattgtttgctcgaattggagacttgtcaccgtgaggcgatggccgatccg
aagttccaggccgagttcaagagctactacggatacatgaaccgtccttcgggattgtat
ttcgcagaacgcctgaccgagcatgtcggtggagccaaaatctggttcaagcgtgaagac
ctcaaccacacgggttctcacaagatcaacaatgccgtcggccagatccttttggctcga
cgattgggcaagacccggatcatcgctgagactggcgccgggcaacatggtgttgcaaca
gctaccgtctgcgcaaggttcggtatggaatgcgtcgtttacatgggtgcagaggatgcc
cggcgacaatctttgaacgtcttccgaatgaaaatgctcggagctcaagtggtcgcagtg
accagtggcagccaaaccctaaaagatgcaatcaacgaagccatgcgtgattgggtgacc
aatgtcagcacaacacattatctcgttggttcggccatcggccctcatcctttccctaca
atcgtccgggacttccaaagtgttatcggacgagagatcaaggatcagctgctggctgaa
ataggtaaattgccagacgcagtgattgcgtgtgtgggtggtggaagtaacgctatcgga
actttccatccgttcatcaatgaaaagagcgtgcgaatgatcggtgtcgaagctgggggg
agtgggacggataccgaccgacattcggcgacgttatccaaagggacgaagggcgtgctc
cacggtgtgctgacctacatcctacagagctccagcgggcagatctcggagacccattcg
atctcggccggactggattacccgggtgtcgggccggagcactcattcttgaaggacgcc
ggtcgggctgagtaccgtgtggctaccgatctcgaggccttgaaaggattccgattgtgc
gtccagttcgaaggtattatccctgcactcgaaactgctcatgccatctggagcactgcc
gaggtggctaaggaacttgggaaggatgccaacatcgtgatgtgtttatctggcagagga
gataaggatgttgagcagattgcacaacagttacccaagttcgctgatgctctggattgg
cacatttcaccttga

DBGET integrated database retrieval system