KEGG   Puccinia graminis: PGTG_11305Help
Entry
PGTG_11305        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
pgr  Puccinia graminis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PGTG_11305
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PGTG_11305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 164 aa AA seqDB search
MGARMQSWFDILGLRPDAPEDEKGLLESVKTIQSLVEKQVQAGIPSERIVVGGFSQGAAI
SILTGLMSPSPLAGVVCLSGFLTLKDKIKQLQTPHASKLNVFWGHGTHDPVVQYQWGAKS
VDFLKEDLGLTNVDFRSYPDLVHSASPLELRHLSEWLMARLPNQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcaaggatgcaatcttggtttgacatcctagggctcagaccagacgccccggag
gacgaaaaaggactgctcgaaagtgtcaagacgatccaatcgttagtcgagaagcaagtc
caagcgggtattccctctgagcggatcgtcgttggaggtttctcgcaaggtgcggcgatc
tctatcctgaccgggctcatgagtccttccccattagccggggtggtttgcctatcggga
ttcttgaccctgaaagacaagatcaaacaactccaaacccctcacgcttccaaactgaac
gtcttttggggacatgggacgcatgatccggttgtccaataccaatggggagccaagtcg
gttgattttctgaaggaagacttgggactcacaaatgttgactttaggtcctatccagat
ttggtccatagtgcttcgccactcgaattgagacatctttcagaatggttgatggctcgt
ctccccaaccaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system