KEGG   Puccinia graminis: PGTG_11433Help
Entry
PGTG_11433        CDS       T02226                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pgr  Puccinia graminis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PGTG_11433
   00670 One carbon pool by folate
    PGTG_11433
Enzymes [BR:pgr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PGTG_11433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 252 aa AA seqDB search
MIPLNLIVCATKSNGIGQAGRLPWRLKEDMNFFKSVTTLAPSGCKNVVIMGRKTWLSIPS
KFRPLANRINIVVSRQSKDPAALDIHQQQDSYLVNSIESACHLIRTLDSPDNNTQQETTT
SVLKERKTGGEPLVNKVFVIGGSEIYKSVLDSQPDNNRLYKPSTILMTRILSEHPAIETS
LDAFFPEFRASKHWSKSQNPDLLNQFLVLPDHQNSSGSVPEPHYQLPFNFDQLIIENSFM
YKFELWTYNNPL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcccactgaacctgatcgtgtgtgcgacgaaatcgaatgggataggccaagcagga
cgactcccatggcggctgaaggaggacatgaacttcttcaaatcggtcaccactctggcc
ccctcaggatgcaagaacgtcgtcatcatgggcaggaagacttggctgagcatccccagc
aagttcagacctctcgctaatcggatcaatatcgtcgtcagtcgacaatctaaagatccg
gctgctctcgatattcatcagcaacaggatagttatctggtcaattcgatcgagtcggcc
tgtcacctcatccgaactcttgactctcccgataacaacactcaacaagaaacaacaaca
tcggtgttgaaggaacgcaagactggcggagaaccgttggttaacaaagtgtttgtgatc
gggggctctgagatatacaaatcagtactcgactctcaaccggacaataacaggctctac
aaaccatcgacgatcttgatgaccaggatcctctctgaacatcccgcaatcgagacatcc
ttggatgcgttctttcccgaatttagagcctctaaacattggtccaagtcgcaaaacccg
gacctactgaaccagttcttggtccttcctgatcatcaaaactcttccggttctgtcccc
gagcctcactatcaactcccgtttaacttcgatcaacttatcatcgaaaactcgttcatg
tataaattcgaactttggacttataacaatcctttataa

DBGET integrated database retrieval system