KEGG   Puccinia graminis: PGTG_11734Help
Entry
PGTG_11734        CDS       T02226                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pgr  Puccinia graminis
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PGTG_11734
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PGTG_11734
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PGTG_11734
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PGTG_11734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 466 aa AA seqDB search
MSKSPQGASSKDGNAVVGGSTIVIKLGTSSILSEQNLQPRLGLLANLVETCVNLRAIGHK
VVLVSSGAIGMGMRRMSLLDGGLQGKWGKKPKSLNEKQALAAIGQGHLIALWDSLFSRLN
QPIAQILLTRGDLADRSRYLNASSTLSTLLNSGVIPIINENDTISVSEIKFGDNDTLSAV
TAAMCHADFLFLMTDVDCLFTANPRSNPSAQMVKVVYDIEGVRKMVSTSTLGSSLGTGGM
ETKLIAAELATAAGVATIICNGTKPQNIAAIISDLQSKPASSSDAIPAILVPPLVEDSGP
SQLNYTVFLPRPTPLTSRKFWVAHGLAPKGSVMIDRGAYEAISDEANGGRLLPAGLVTVY
GTFAVAQAVTILVPRSFLTPLSAPPASVEQEQSSDLPLPTSSSSQTNQTAEELVPVGRGL
VNYNSSDMNKLKGLHSSEIESAIGHIDSEHVIESIVLFKPISPPHS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtcgccccaaggagcctcttcgaaggatggaaacgccgtggtcgggggttcg
acaatcgtcatcaaactaggaacttcgtctatcctttctgaacagaacctccaaccacgc
ttgggtctgctggccaacttggtagaaacatgcgtcaatttgagagccatcggacacaag
gtcgtcttggtctcatccggcgctatcgggatgggaatgagacgaatgtcgctgctcgat
ggtggcttgcaggggaaatggggcaagaaaccaaagtcattgaacgagaaacaagcgttg
gctgcgatcggacagggtcatttgattgcactatgggatagcctctttagtcgtctcaac
cagccgattgctcagattctcttaacgcgaggagatttggcagatagatcgaggtacttg
aatgcctcttccaccctgagcaccttattgaacagtggagtgattccgatcatcaatgag
aacgataccatctcggtctccgagatcaaatttggtgacaacgataccctttccgccgtc
actgcagccatgtgtcatgccgatttcctgttcctcatgaccgatgtcgactgcttgttc
accgccaatccccggtccaatccatctgctcaaatggtcaaggtcgtctacgatatcgaa
ggggttcgaaaaatggtatctacatctaccttaggctcatccctgggaacaggggggatg
gaaaccaagcttatcgcggccgaactggcgaccgctgcaggtgtagccacgataatctgt
aacggcacgaagccacagaacatagcggcgattatatccgacttgcaatccaagccagcc
agctcttccgacgcgatcccagccatactggtgcctccactagttgaagattcggggcct
tctcaattgaactacaccgtcttccttccccggccgaccccactgaccagccggaagttt
tgggtcgcccacggcttggcgcccaagggttcggtgatgatcgacagaggcgcctatgag
gcaatcagtgacgaggccaacggcggcaggctactccctgccggtctggtcaccgtttac
ggcacctttgccgtcgcccaggccgtcactatcctcgtcccaagaagttttctcactcct
ctatccgccccacccgcatcagtcgagcaagaacagtcgtcggaccttcctctccctact
tcttcaagctctcagacaaatcaaactgcagaagaactggttccagtaggccgtggacta
gtgaactataactcctcagacatgaacaaactgaaaggtcttcacagctctgagatcgaa
tcggccatcggacatatcgactcggaacatgtgatcgagtcgatcgtcttgttcaagccg
atctcaccgcctcactcataa

DBGET integrated database retrieval system