KEGG   Puccinia graminis: PGTG_11747Help
Entry
PGTG_11747        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K05759  
profilin
Organism
pgr  Puccinia graminis
Brite
Membrane trafficking [BR:pgr04131]
 Others
  Actin-binding proteins
   Others
    PGTG_11747
Cytoskeleton proteins [BR:pgr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     PGTG_11747
Exosome [BR:pgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   PGTG_11747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQAYVDTNLLGTGLFDNAAILGQAGGVWATSSDFNIAPDEQSKLVNGFEDNPTIQASG
VILAGTKYLTIHADDRSVYGKKGGAGCVCVKTKQAVIVALYKAGVQPGEATKCTEALADY
LIASGF
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcgtacgttgacaccaacttgttgggaactggtctatttgacaatgca
gcgatcctaggacaagccggaggcgtatgggctacatcctcagatttcaatattgcgccc
gacgagcagagtaaactcgtcaacggattcgaggataacccaacgatccaagcatctgga
gtcatcttggccggaaccaaatatttgaccatccatgcagatgatcgaagtgtttacgga
aagaaaggaggggctggatgtgtgtgtgtcaaaaccaagcaagccgttatcgtagcacta
tacaaggctggtgttcaaccaggtgaagctacgaagtgcaccgaagcactggccgattat
ttgattgcttcaggcttctaa

DBGET integrated database retrieval system