KEGG   Puccinia graminis: PGTG_13070Help
Entry
PGTG_13070        CDS       T02226                                 

Definition
translation initiation factor eIF-3 subunit 9
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pgr  Puccinia graminis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PGTG_13070
Messenger RNA biogenesis [BR:pgr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     PGTG_13070
Translation factors [BR:pgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PGTG_13070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 751 aa AA seqDB search
MVANGKEVDHFSDEEDSDLEIDYTDIEERFRPKFQDTFDNLIVVEGAPIVDESKRGRLIK
AIISTFAKKDLKISESKIEMPLDPNNQSKGYLFIELNSPQDADRAVRNLHDYPFDKKHRF
TVIKFTEVERFAHVAENFVKPVLEEYKPRSHLKSWLADPQGRDQMIIYQGDDVKVAWHGR
NGAPDVAHKRTKWTDAYCAWSPDGTMLATIHNQGVALWGGANFDRIHRLYHPKVKLIDFS
PMENYLVTWSDQPIELPTDPQAPQIFSEDDEGNSIAVWDVVTGKLLRTFPVLTPSSEEEG
GARIKFQWPMFKWSGDDRYLARVTPGQAISVYETPGMGLLDKKSIKIEGVVDFEWCPLSE
NERDAILEARNLLPSASFDEPSSDSKPKKNAGERSNMLAFWTPEVANQPARVSLMNIPSR
DTLRSKNLFNVHDAKIHWQSNGDYVCVKVDRHTKTKKTTYCNLELFRVRDKSFPVDVIEI
KDTVTAFAWEPKGNRFILITSNDPNLSQGPTPGTTIKTNIHFFGMDVKKGDFRLFKTYDG
KTCNSVHWSPKGRHVVTATLGSSSKCDLEFWDTDLDESDKDLGSGISLLSSVEHYGMTEL
EWDPSGRYLASIGSMWLSSLECGYTIWDFKGELMHKVTLERFKQLLWRPRPRSLLSKETQ
RKIRKNLREYSKQFEEEDQLEASNVSAELVAHRRRLLEEWDSWRRHSKQELATEASRAGK
LSAAQKAADPADSEQIEEWIEEVIEETETML
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaaacggaaaggaagtcgaccacttcagcgatgaggaagattctgatctcgag
atcgactacacggatatcgaggaacgattccgacccaagttccaagatacctttgataac
ctcatcgtcgtcgagggtgcacccatcgtcgatgaatccaaacgaggcagattgatcaaa
gctatcatatccaccttcgctaaaaaagatctcaagatctccgagtcaaagattgagatg
cctctggatcccaataatcagagtaaaggttatcttttcattgagctcaatagtccccaa
gacgccgatcgggccgtgcgaaacttgcacgactaccctttcgacaagaagcatcggttc
acagtgatcaagttcactgaggtcgaacgatttgcccatgtggccgagaactttgtaaaa
ccggtattggaagagtacaagcctcggagtcacttgaagagttggctagccgatccccaa
ggtcgtgaccagatgatcatctatcaaggtgatgatgtcaaggttgcctggcatggccgg
aacggggctcccgacgttgctcacaaacgaaccaaatggactgatgcctactgtgcctgg
tctccagatggtacaatgctagccacgattcacaatcaaggggttgccctctggggtgga
gcaaacttcgatcggatccatcggctctaccatccgaaggtgaaactgatcgacttttca
cccatggagaattatctcgtcacctggtccgatcagccaatcgagctccccaccgaccct
caagcgcctcagatcttctctgaagacgatgaagggaatagtattgcagtctgggacgtc
gtcactggaaaattactgcggacgttcccagtgctcaccccgtcatcagaagaagagggt
ggggcacgaatcaagttccagtggccaatgttcaaatggagtggggacgatcgttacctg
gctcgggtgacgcctggacaggctatcagtgtctacgaaacacccgggatgggtttactt
gacaaaaagagtatcaagatcgaaggagttgtcgacttcgagtggtgtcccttaagcgaa
aacgagcgtgatgccatcttggaagctcgaaacttgctcccgagcgcttcattcgatgag
cctagttcggactccaaacccaagaagaacgctggagaaagatcgaacatgttggctttc
tggacccctgaagttgccaaccagcctgcgagagtctcattaatgaacataccatctcgt
gataccctacgttccaagaatctcttcaatgttcacgacgccaagatacactggcaatcc
aatggtgattatgtctgcgtaaaagttgaccgacacacgaaaacgaaaaagacaacctac
tgcaaccttgaattgttccgggttcgagacaagtctttccccgttgatgtgattgagatt
aaagatactgtcaccgcttttgcttgggaacccaaggggaatcgatttattttgattacc
agtaacgatcctaacttgtcccaaggtccaactccgggaacgacaatcaagaccaatata
cacttttttgggatggacgtcaagaaaggagacttccgtttgttcaaaacatacgacggc
aagacgtgtaactcggtgcactggtctcccaagggcagacacgttgtcactgccacccta
gggtctagctctaaatgtgatctcgagttttgggataccgatcttgatgagagcgacaaa
gacctgggatccggaatctctctcctctcatctgttgaacattatggtatgaccgaattg
gagtgggatccgagtggcagatatttggccagtattggaagcatgtggctaagctcactt
gaatgcggatacaccatctgggacttcaagggagaattgatgcacaaagtgacgctggaa
agatttaagcaactattatggcgaccacgacctcggtcgttgttgagcaaggagacgcaa
cggaagatcaggaagaacttgcgagagtacagcaaacagttcgaggaggaggatcaactg
gaggccagcaatgtgagtgcggagttggtggcccatcgacgacgattgctcgaagaatgg
gactcctggagacgtcactcgaaacaagaacttgctacggaggccagtcgggccggtaaa
ctctcagctgctcagaaagctgccgatcccgccgattcggaacagatcgaggaatggatc
gaggaggttattgaagaaactgagacgatgctttga

DBGET integrated database retrieval system